DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCC88 and GCC1

DIOPT Version :8

Sequence 1:NP_650055.1 Gene:GCC88 / 41350 FlyBaseID:FBgn0037881 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_078799.2 Gene:GCC1 / 79571 HGNCID:19095 Length:775 Species:Homo sapiens

Alignment Length:792 Identity:236/793 (30%)
Similarity:401/793 (51%) Gaps:153/793 (19%)


  Fly     5 QRELEALVSTQKEQLGRYEKRLKDVVTAYKGLLKEKEALETS---LAAHAEATAVGESG------ 60
            :::|...:.|||:||.:|:.||||||.|||.|||||||||.|   |:...||. ||.:|      
Human    14 KKDLLETIETQKKQLLQYQARLKDVVRAYKSLLKEKEALEASIKVLSVSHEAD-VGLAGVQLPGL 77

  Fly    61 -----------SPARELESKKTSTDSADGAT----------EGAAPGPPAPPAE----------- 93
                       :.:.:.....||.|:|...|          :..|.|||.|.:|           
Human    78 TFPDSVDDRCSTHSEDSTGTATSLDTAASLTSTKGEFGVEDDRPARGPPPPKSEEASWSESGVSS 142

  Fly    94 ----------------GQLQTQIITLMNSLATLSAEKSRMEASFQADKKQLRSQIAQKEQTIQEL 142
                            .||:||:.||.:||||::.||||||||:.||||:::       |.:::.
Human   143 SSGDGPFAGGEVDKRLHQLKTQLATLTSSLATVTQEKSRMEASYLADKKKMK-------QDLEDA 200

  Fly   143 NTRAKEQAARAKSD-------VDEIKAKWIVERQEREKETNNQMLMIRELQKLYADERHLKDNIE 200
            :.:|:|:.||.:.:       :.|.||:.|.::.:|.:|.::..||:||||||..:||..:.::|
Human   201 SNKAEEERARLEGELKGLQEQIAETKARLITQQHDRAQEQSDHALMLRELQKLLQEERTQRQDLE 265

  Fly   201 MQLNNFKTQFASNEAENSRLRELQSQLKEARSQLKQFQAKTEHSAAASASADSAALLQQVRLEMQ 265
            ::|...:...|.......::...:.|.|:...::::.  |:|..|...........||:::.|..
Human   266 LRLEETREALAGRAYAAEQMEGFELQTKQLTREVEEL--KSELQAIRDEKNQPDPRLQELQEEAA 328

  Fly   266 QLKEQHAVAIRQEQRRVLRAEEQSRRQAALHEDRVASLEARLAELSTTVGSYDRLRQQDQDSIHD 330
            :||......::||.|:...||:|.|:|:.:.|.|||:||.:::|:|..:|:|::.:|:||.:|..
Human   329 RLKSHFQAQLQQEMRKTALAEDQLRQQSQVEEQRVAALENQISEVSELLGTYEKAKQKDQLAIQK 393

  Fly   331 LKQQL--QDLEQ------AHVRPTSNSRALNEDVDVATLVDEMVRLKKLLTTANARSANPLDLG- 386
            ||:::  .|||.      |..|...:|......:||..|.|:|.:||:||..|..:|...||:. 
Human   394 LKERILQLDLENKTLALAASSRSPLDSHGEESSLDVNVLKDKMEKLKRLLQVAARKSQVTLDVEK 458

  Fly   387 ----EILSFS----GQTATRVESHAHCEQQLQGVQQMLEASKQQRQL-----------LEQKVQL 432
                ||:..|    |:.||.:    :.:|:|:.:::..|..|.:.|:           |.::::.
Human   459 LCDLEIMPSSEAADGEKATAL----YYQQELKQLKEEFERYKMRAQVVLKSKNTKDGNLGKELEA 519

  Fly   433 QHSHIQTLQEKVQVLNRNIDEAEVELKQQGEKLRLALKNERTKWQEA-KAELENETRCKLN---- 492
            ....:..|:||...|..:.:|.|.:.:|:.:.    .|.|..:.|:. :.|||   ||:|:    
Human   520 AQEQLAELKEKYISLRLSCEELEHQHQQEADD----WKQELARLQQLHRQELE---RCQLDFRDR 577

  Fly   493 --ELEQLLQKQRQRSLQLLDEKEQEIKTLQTSFEVFHSASGV--------GSTLATPTLEAAADS 547
              :||:.|.|||.|:|.:|.||:.|::.|::    ...|||:        |.....|     || 
Human   578 TLKLEEELHKQRDRALAVLTEKDLELEQLRS----VALASGLPGRRSPVGGGGPGDP-----AD- 632

  Fly   548 FHYSSDTDSVEGEQRERKLKVRSKKMSMGENCHMLHYANELARKDIEITTLRKAKYAAESTLRKA 612
               :|.:||:          .::.:::.........||.:||||::|||:|||.|:..|..:.: 
Human   633 ---TSSSDSL----------TQALQLAAANEPTFFLYAEQLARKEVEITSLRKQKHRLEVEVHQ- 683

  Fly   613 IQDKVTSQQEMH-EKIECLKEQVDRLERCKTREGANLEYLKNVIISYIVTRDADGKRHMLNAISA 676
            :||::..:.|.| |::..|:..:::..|.::|||||||||||:|..::...|:.|::..|.||..
Human   684 LQDRLLEEGERHREEVAALQSHIEKNIRDQSREGANLEYLKNIIYRFLTLPDSLGRQQTLTAILT 748

  Fly   677 VLQFTAAEMQAI 688
            :|.|:..|.|.|
Human   749 ILHFSPEEKQVI 760

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCC88NP_650055.1 GRIP 646..688 CDD:279767 18/42 (43%)
GCC1NP_078799.2 SMC_N <170..587 CDD:330553 124/437 (28%)
DUF3084 482..>703 CDD:331293 65/252 (26%)
GRIP 717..760 CDD:307561 19/43 (44%)
GRIP domain 719..760 17/41 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C270668310
eggNOG 1 0.900 E1_28HRG
Hieranoid 1 1.000
Homologene 1 1.000 H11567
Inparanoid 1 1.050 287 1.000 Inparanoid score I2802
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D415424at33208
OrthoFinder 1 1.000 FOG0007680
OrthoInspector 1 1.000 T1074088
orthoMCL 1 0.900 OOG5_133492
Panther 1 1.100 LDO PTHR23157
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5435
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.