DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCC88 and gcc-2

DIOPT Version :8

Sequence 1:NP_650055.1 Gene:GCC88 / 41350 FlyBaseID:FBgn0037881 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001022748.1 Gene:gcc-2 / 176378 WormBaseID:WBGene00011503 Length:660 Species:Caenorhabditis elegans

Alignment Length:664 Identity:147/665 (22%)
Similarity:265/665 (40%) Gaps:161/665 (24%)


  Fly   125 KKQLRSQIAQ--KEQTIQELNTRAK-EQAARAKSDVDEIKAKWIVER---QEREKETNNQMLMIR 183
            |||: :.:|:  |.||......:|| .:..:.|.|.:.:|.  |.|:   :..:|..||......
 Worm    37 KKQV-AHVAEMKKNQTALMEKLKAKMSELEQVKKDAENLKL--INEKLTTESAKKVENNPTECTE 98

  Fly   184 ELQKLYADERHLKDNIEMQLNNFKTQFASNEAE--NSRLRELQSQLKEARSQLKQFQAKTEHSAA 246
            .|.|..|       .||::...|:.:..:..|:  :..||:|:|::.:....|:.   |||    
 Worm    99 CLSKSGA-------LIELEKEVFEWKEKATRADMISLELRDLESKVDQLNRALRD---KTE---- 149

  Fly   247 ASASADSAALLQQVRLEMQQLKEQ------HAVAIRQEQRRVLRAEEQSRRQAALHEDRVASLEA 305
              |...:..::.:..||:..:|::      ....:.:|..|:.:|.:..:.::|..|.|:.|.|.
 Worm   150 --ALIKAQEVITENDLEVNNMKKEKNNTKSSIEKLTEENTRLTKALQDEKIKSADFEARLRSAEC 212

  Fly   306 RLAELSTTVGSYDRLRQQDQDSIHDLKQQLQDLEQAHVRPTSNSRALNEDVDVATLVDEMVRLKK 370
            |:.|||.         ||..:.: .|.:::.:.|       :..|.|.|.|||....:|.:..|.
 Worm   213 RIVELSD---------QQGNEKL-GLARKMAESE-------NRGRILEEAVDVLKSENEKLLAKN 260

  Fly   371 LLTTANARSANPLDLGEILSFSGQTATRVESHAHCEQQLQGVQQMLEASKQQRQLLEQKV-QLQH 434
            ...:|...|:..    |...|..::...:|.....|.:.:...:.||.||.....|||:. |.:.
 Worm   261 EEFSAKLVSSEK----EFAEFKKKSHFVLEKKGKQEDETRKAIEKLEKSKVTITELEQQADQTRQ 321

  Fly   435 SHIQT-------------LQEKVQVLNRNIDEAEV-------ELKQQG--------EKLRLALKN 471
            .|.:|             |::.::||...:.|:|.       ||:...        |:|||...:
 Worm   322 EHFKTVEDLASSRDKAERLEKTLKVLKSELTESEKAHTTAIDELQSSSSKLIQRLDEELRLMRSS 386

  Fly   472 ERTKWQEAK-AELENETRCKLNELEQLLQKQRQRS--------------LQLLDEKEQEIKTLQT 521
            ..|..|:.| .|:..|      :::.|||.:||||              .:.:...|:|::.|:.
 Worm   387 RDTAEQKIKDIEIAKE------KVDHLLQNERQRSENENGSLKSKLSSATKQIHSLEKELQELRN 445

  Fly   522 SFEV-------FHSASGVGSTLATPTL--EAAADSFHYS----SDTDSV----EGEQRERKL--- 566
            .||.       ......:.:.:..|..  |......||.    :.:|||    |..|.:|.|   
 Worm   446 DFETRRIQSNQHQQQKAIAAVVPQPIQLPEHPIPPLHYQRPAVAPSDSVSCYDEPTQPDRSLEDV 510

  Fly   567 ---------KVRSKKMSMGENCHMLHYANELARKDI--EITTLRKAKYAAESTLRKA--IQDKVT 618
                     :|.|.::|            |...|.|  ::..|:|..:.....|..|  ...::|
 Worm   511 LYGDLGDEYRVESDELS------------EEKFKVILDQLENLKKTNHHVAELLSDAETANGRLT 563

  Fly   619 SQQEMHEKIECLKEQVDRLERCKTREG-----ANLEYLKNVIISYIVTRDADGKR-HMLNAISAV 677
            :|..:      ||:::.||||.:.||.     .|:||||||.:.::.......:| .::..:..|
 Worm   564 TQNSL------LKDEIRRLEREEKREAELSNEKNMEYLKNVFVQFLKPESVPAERDQLVIVLQRV 622

  Fly   678 LQFTAAEMQAINAS 691
            |..:..|::.:.|:
 Worm   623 LHLSPKEVEILKAA 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCC88NP_650055.1 GRIP 646..688 CDD:279767 11/43 (26%)
gcc-2NP_001022748.1 Grip 589..636 CDD:197860 12/47 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23157
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.