DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCC88 and gcc1

DIOPT Version :8

Sequence 1:NP_650055.1 Gene:GCC88 / 41350 FlyBaseID:FBgn0037881 Length:695 Species:Drosophila melanogaster
Sequence 2:XP_002939415.1 Gene:gcc1 / 100380087 XenbaseID:XB-GENE-1007438 Length:704 Species:Xenopus tropicalis

Alignment Length:758 Identity:203/759 (27%)
Similarity:368/759 (48%) Gaps:158/759 (21%)


  Fly     5 QRELEALVSTQKEQLGRYEKRLKDVVTAYKGLLKEKEALETSL-----------------AAHAE 52
            ::||:..|.||::||.:|:.||||||.|||.|.|||||||.||                 .||.:
 Frog    14 KKELQEQVETQRKQLQQYQGRLKDVVRAYKSLQKEKEALEASLHVLSTTQEPGTLFSESEEAHDD 78

  Fly    53 ATAV-----------------GESGSPARELESKKTSTDSADGATEG----AAPGPPAPPAEG-- 94
            ..::                 ||:....|...|::...:.|.|:..|    :..|..|...|.  
 Frog    79 QHSIHSEDSVDTAGSLPSARGGETSEDERPDPSQRGGIEEASGSESGVSTASGEGGQATAVETDR 143

  Fly    95 ---QLQTQIITLMNSLATLSAEKSRMEASFQADKKQLRSQIAQKEQTIQELNTRAKEQAARAKSD 156
               ||:.|:.||.::|||::.||||||||:||||:..:.::.:...:..:..|:.:|:....:..
 Frog   144 KMVQLKNQLSTLTSALATVTQEKSRMEASYQADKRNAKQEMEELMLSFVQERTKLQEEIQSIQEQ 208

  Fly   157 VDEIKAKWIVERQEREKETNNQMLMIRELQKLYADERHLKDNIEMQLNNFKTQFASN-------- 213
            :.|.||:.|.::.:|.:|..:.::|::|||:|...||..:...|::|...:.:.|..        
 Frog   209 LAETKARLISQQHDRAQEQTDHVIMLKELQRLLQGERDHRQEAELRLEEARQELAGKLAGISELE 273

  Fly   214 ------EAENSRLR----ELQSQLKEARSQLKQFQAKTEHSAAASASADSAALLQQVRLEMQQLK 268
                  |.:|.:||    ||:.::.|||.|              .|..|.|  :::::.|:.::|
 Frog   274 GRSEVAEEQNRKLRKDLEELRKEIMEARRQ--------------GAEPDPA--VKKLQAELDRVK 322

  Fly   269 EQHAVAIRQEQRRVLRAEEQSRRQAALHEDRVASLEARLAELSTTVGSYDRLRQQDQDSIHDLKQ 333
            |:....:::|:::.|..|:::.::....|.|:.|||::::|:|..:|:.:..:|:||.:|..|::
 Frog   323 EEMHALLQEERKKKLDEEQETMQRFLQEEQRICSLESQVSEMSELLGAAETSKQRDQATIRKLRE 387

  Fly   334 QLQDLEQAHVRPTSNSRALNEDVDVATLVDEMVRLKKLLTTANARSANPLDLGEILSFSGQTATR 398
            :|..||     ..:.:.||...:...:.|           |.|......:|.|.           
 Frog   388 RLIQLE-----AENKTLALTSSMQTPSEV-----------TFNFNKGEDMDEGP----------- 425

  Fly   399 VESHAHC---EQQLQGVQQMLEASKQQRQ-------LLEQKVQLQHSHIQTLQEKVQVLNRNIDE 453
             |.||..   :|:||.:::..|..|.:.|       ..|.:::.....:..|:|:...|..:.:|
 Frog   426 -EQHASVLFYQQELQQLKEEFERYKSRAQGVLRTKGAREGELEAGKKQMAELKERCVSLRLSAEE 489

  Fly   454 AE----VELKQQGEKLRLALKNERTKWQEAKAELENETRCKLNELEQLLQKQRQRSLQLLDEKEQ 514
            ||    .|::...:::.|.|::.|   ||.:: :..|.|..:..||:.:::.|:|.|.:|.||||
 Frog   490 AESQHKAEMEAAQKQIALMLQSHR---QELES-VRKEGRDNMARLEEEVRQHRERVLAVLAEKEQ 550

  Fly   515 EIKTLQTSFEVFHSASGVGSTLATPTLEAAADSFHYSSDTDSVEGEQRERKLKVRSKKMSMGENC 579
            |::.|:        .:.:.|.:....|::..:..                       ::|.|.:.
 Frog   551 ELEKLR--------ETKITSVVPLSVLDSIGNGL-----------------------ELSQGASS 584

  Fly   580 HMLHYANELARKDIEITTLRKAKYAAESTLRKAIQDKVTSQQEMHEKIECLKEQVDRLERCKTRE 644
            ..:.||.:|:||:.||..||:.|:..||.| :::|:|:..|:   |:...|:||:.:..|.:.||
 Frog   585 TFIVYAEQLSRKEAEIGNLRRRKHELESEL-QSMQEKLAEQK---EEANILQEQMKKNVRDRRRE 645

  Fly   645 GANLEYLKNVIISYIVTRDADGKRHMLNAISAVLQFTAAEMQA 687
            |||:||||||::.|:...|..|::|.|:|:.|||.|:..|..|
 Frog   646 GANMEYLKNVLLGYLTLPDPRGRQHTLSALLAVLHFSPEERNA 688

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCC88NP_650055.1 GRIP 646..688 CDD:279767 20/43 (47%)
gcc1XP_002939415.1 Tmemb_cc2 14..>226 CDD:287269 66/212 (31%)
GRIP 647..688 CDD:279767 19/41 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C270671048
eggNOG 1 0.900 E1_28HRG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D415424at33208
OrthoFinder 1 1.000 FOG0007680
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.