DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and AZF1

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_014756.3 Gene:AZF1 SGDID:S000005639 Length:914 Species:Saccharomyces cerevisiae

Alignment Length:394 Identity:83/395 (21%)
Similarity:145/395 (37%) Gaps:111/395 (28%)


  Fly   254 NENPISS----------DHDLISDTENTN----VEEIEDAGGDHVEDEATSDDQTSQEAVDEVAE 304
            |:|.|:|          ||.|.|....:|    ::|||.....|:.||   |:.:|         
Yeast   384 NDNSINSATSTNIPNQEDHSLASTDTTSNSRKDLKEIEQRLRKHLNDE---DNYSS--------- 436

  Fly   305 SPAAQDPL---SVALGAKIFKELLDQYTGKEKARLRK------------GAPIASKPKAKEKA-- 352
              |...||   .|..|::...:.:|: :|.:...::|            ..|....|.:|:.:  
Yeast   437 --AISRPLDKNDVIEGSEGLNKHIDE-SGMQPNIIKKRKKDDSTVYVKNEMPRTDPPMSKDNSTS 498

  Fly   353 ---------AGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHT 408
                     :|::.|....:..:.:..|||...::         ||            :.::...
Yeast   499 AEGAAMANFSGKEPPIPDISSVSDDATNLIGATKV---------DQ------------LMLIIQA 542

  Fly   409 RTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIV 473
            |.|.:  ||...|..|             |:..|     ::|.           ::......|:.
Yeast   543 RKKGF--TEKVNTTQD-------------GDLLF-----NQTM-----------DILPPKSELVG 576

  Fly   474 KRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEM 538
            ....||.....|...:::|..|.:.::....|..|::||.....:.|..|.|.::....|:.||.
Yeast   577 GVEKPKGTQNTRAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHER 641

  Fly   539 THE-KRPLQCDVCLKGFYQRTRLREHELIHTGERPYWC--EVCNVNFRYKYNMKSHANSKMHQDN 600
            .|. ::|..||:|.|.|.::..|..|.:.|...:|:.|  |.||..|....|||:|.| :.|::.
Yeast   642 LHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQN-RFHKET 705

  Fly   601 ARKL 604
            ...|
Yeast   706 LNAL 709

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871
zf-C2H2 385..407 CDD:278523 2/22 (9%)
C2H2 Zn finger 387..407 CDD:275368 2/20 (10%)
zf-H2C2_2 399..422 CDD:290200 5/23 (22%)
C2H2 Zn finger 415..436 CDD:275368 4/21 (19%)
C2H2 Zn finger 444..460 CDD:275368 1/16 (6%)
C2H2 Zn finger 492..512 CDD:275368 5/20 (25%)
C2H2 Zn finger 520..540 CDD:275368 6/20 (30%)
C2H2 Zn finger 547..567 CDD:275368 7/20 (35%)
zf-met 574..597 CDD:289631 10/25 (40%)
C2H2 Zn finger 575..591 CDD:275368 8/18 (44%)
AZF1NP_014756.3 COG5048 342..768 CDD:227381 83/395 (21%)
zf-C2H2 593..615 CDD:278523 5/22 (23%)
C2H2 Zn finger 595..615 CDD:275368 5/20 (25%)
zf-H2C2_2 607..632 CDD:290200 7/25 (28%)
C2H2 Zn finger 623..643 CDD:275368 6/20 (30%)
zf-H2C2_2 635..660 CDD:290200 10/25 (40%)
C2H2 Zn finger 651..671 CDD:275368 7/20 (35%)
C2H2 Zn finger 679..702 CDD:275368 10/24 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.833 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.