DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and TT1

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_174737.2 Gene:TT1 AraportID:AT1G34790 Length:303 Species:Arabidopsis thaliana

Alignment Length:385 Identity:76/386 (20%)
Similarity:120/386 (31%) Gaps:145/386 (38%)


  Fly   223 QAIDF-----REMCISTELKLSQAKPSTDEVQIEAE---NENPISSDHDLISDTENTNVEEIEDA 279
            |::|.     :..||:.  .|.:..|..|.:.:.:.   |.||:.::.                 
plant    23 QSLDLFPNLNQNSCINN--TLIEPLPLIDRINLNSNLDLNPNPLYAEE----------------- 68

  Fly   280 GGDHVEDEATSDDQTSQEAVDEVAESPAAQDPLSVALGAKIFKELLDQYTGKEKARLRKGAPIAS 344
             |:..|:|...:|:  :..||.....|....|.:.|       :.|.:..|||.|....|..|.:
plant    69 -GEQEEEEEEEEDR--EVDVDLHIGLPGFGKPSNDA-------KQLKKRNGKEIATYDAGKGIEN 123

  Fly   345 KPKAKEKAAGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTR 409
              :...||.....|:                 |:.....:|.|..|.:.|...:||::||..|  
plant   124 --ELSGKAYWIPAPE-----------------QILIGFTHFSCHVCFKTFNRYNNLQMHMWGH-- 167

  Fly   410 TKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFA-----CGFCSETFAYPGARQKHESEVHNAAP 469
              ..|..:.|::.              :|..|.|     |..|.|     |.|.      |...|
plant   168 --GSQYRKGPESL--------------KGTQPRAMLGIPCYCCVE-----GCRN------HIDHP 205

  Fly   470 RLIVKRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLK 534
            |           .||.:..|    ..|.||..|                                
plant   206 R-----------SKPLKDFR----TLQTHYKRK-------------------------------- 223

  Fly   535 RHEMTHEKRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANS 594
                 |..:|..|.:|.|....:...|.||. :.|:|  |..||..:|::|.::|.|..:
plant   224 -----HGHKPFSCRLCGKLLAVKGDWRTHEK-NCGKR--WVCVCGSDFKHKRSLKDHVKA 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 5/22 (23%)
zf-C2H2 385..407 CDD:278523 8/22 (36%)
C2H2 Zn finger 387..407 CDD:275368 7/20 (35%)
zf-H2C2_2 399..422 CDD:290200 7/23 (30%)
C2H2 Zn finger 415..436 CDD:275368 1/21 (5%)
C2H2 Zn finger 444..460 CDD:275368 5/16 (31%)
C2H2 Zn finger 492..512 CDD:275368 4/20 (20%)
C2H2 Zn finger 520..540 CDD:275368 0/20 (0%)
C2H2 Zn finger 547..567 CDD:275368 6/20 (30%)
zf-met 574..597 CDD:289631 7/22 (32%)
C2H2 Zn finger 575..591 CDD:275368 5/16 (31%)
TT1NP_174737.2 C2H2 Zn finger 231..247 CDD:275368 4/16 (25%)
C2H2 Zn finger 257..274 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.