DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and WIP3

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_172306.1 Gene:WIP3 AraportID:AT1G08290 Length:337 Species:Arabidopsis thaliana

Alignment Length:187 Identity:46/188 (24%)
Similarity:64/188 (34%) Gaps:46/188 (24%)


  Fly   418 CPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQK----HESEVHNAAPRLIVKRINP 478
            |.|.|:......:|:     |...|||..||:||......|.    |.||....|..|       
plant   161 CGKRFWIPSPAQIHV-----GPMQFACSICSKTFNRYNNMQMHMWGHGSEFRKGADSL------- 213

  Fly   479 KPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQR-----CSKSYSDPNKLKRH-E 537
            |...:|...:|..|..|                     |..|:.     .||...|...|:.| :
plant   214 KGTIQPAAILRLPCYCC---------------------AEGCKNNINHPRSKPLKDFRTLQTHYK 257

  Fly   538 MTHEKRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANS 594
            ..|..:|..|..|.|....:...|.||. :.|:  .|...|..:|::|.::|.|..|
plant   258 RKHGSKPFSCGKCGKALAVKGDWRTHEK-NCGK--LWYCTCGSDFKHKRSLKDHIRS 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871
zf-C2H2 385..407 CDD:278523
C2H2 Zn finger 387..407 CDD:275368
zf-H2C2_2 399..422 CDD:290200 2/4 (50%)
C2H2 Zn finger 415..436 CDD:275368 4/18 (22%)
C2H2 Zn finger 444..460 CDD:275368 6/20 (30%)
C2H2 Zn finger 492..512 CDD:275368 2/20 (10%)
C2H2 Zn finger 520..540 CDD:275368 6/26 (23%)
C2H2 Zn finger 547..567 CDD:275368 6/20 (30%)
zf-met 574..597 CDD:289631 7/22 (32%)
C2H2 Zn finger 575..591 CDD:275368 4/16 (25%)
WIP3NP_172306.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.