DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and CG18764

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_652712.2 Gene:CG18764 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster

Alignment Length:497 Identity:132/498 (27%)
Similarity:202/498 (41%) Gaps:144/498 (29%)


  Fly   166 KCRTC----YNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQAID 226
            :||||    ||..     .|:||...|..:|..|.:::|..:.:.|:.|..:|..|...|:|||.
  Fly     4 QCRTCGSIIYNKM-----PKNLFHIENEKMLQDINLVTGTTLHNDPELPSSICACCTLDLNQAIL 63

  Fly   227 FREMCISTELKL------SQAKPSTDEVQ-------------------IEAENENPISSDHDLIS 266
            |||.||.|:.:|      .:||...::|:                   |....|..:..|.|...
  Fly    64 FRERCILTQKQLVHRRRSPEAKEPAEDVEEMASPPDCLNDPFGEVDEYIVESPEEVLDHDSDAHH 128

  Fly   267 DTENTN-VEEIEDAGGDHVEDEATSDDQTSQE------AVDEVAESPAAQDPLS------VALGA 318
            |.:..| ::.:||.  |.::|.|...::.||:      :|.:..||....|..|      .....
  Fly   129 DLDEDNYIDSVEDV--DALQDMAEVAEEDSQDVESLISSVQKELESICNDDSNSDNNDYMEPQNG 191

  Fly   319 KIFKELLDQYTGKEKARLRKGAPIASKPKAKEKAAGEQKPKRSANPKTKE---------ERNLIR 374
            ..|.|.:::|.....       |....|::|..|....|| .:..||.|:         |..:|.
  Fly   192 SYFNETINEYEVSSN-------PNTPLPESKSAAGRSTKP-ATTKPKRKKQYVTWKNMTEEQIIE 248

  Fly   375 RAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGE 439
            |.:|:.| ...||:|||:.|....|.::||||||..||:.|.:|.|.||..::..:|.||.|:||
  Fly   249 RKRLQRK-RECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGE 312

  Fly   440 TPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKYA 504
            .|:.|.||:::|             ||:..|||                                
  Fly   313 KPYDCRFCTKSF-------------HNSNTRLI-------------------------------- 332

  Fly   505 LGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHEKRPLQCDVCLKGFYQRTRLREHELIHTG 569
               |.::||:|..|.|..|.|.:...:..||                           |||||||
  Fly   333 ---HERTHTNAKPYSCHHCDKCFKSASGRKR---------------------------HELIHTG 367

  Fly   570 ERPYWCEVCNVNFRYKYNMKSHANSKMHQDNARKLG--VVQI 609
            .|.:.|.:|..:|:...::|:|..||.|...|:.:|  |:|:
  Fly   368 VRAFACTICKQSFQRNTHLKAHLRSKFHTAKAKTIGAEVLQL 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 28/83 (34%)
zf-C2H2 385..407 CDD:278523 11/22 (50%)
C2H2 Zn finger 387..407 CDD:275368 10/20 (50%)
zf-H2C2_2 399..422 CDD:290200 12/23 (52%)
C2H2 Zn finger 415..436 CDD:275368 8/21 (38%)
C2H2 Zn finger 444..460 CDD:275368 4/16 (25%)
C2H2 Zn finger 492..512 CDD:275368 1/20 (5%)
C2H2 Zn finger 520..540 CDD:275368 5/20 (25%)
C2H2 Zn finger 547..567 CDD:275368 4/20 (20%)
zf-met 574..597 CDD:289631 7/23 (30%)
C2H2 Zn finger 575..591 CDD:275368 4/16 (25%)
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 27/76 (36%)
C2H2 Zn finger 260..280 CDD:275368 10/20 (50%)
zf-H2C2_2 272..297 CDD:290200 14/25 (56%)
C2H2 Zn finger 288..309 CDD:275368 8/21 (38%)
C2H2 Zn finger 317..337 CDD:275368 10/68 (15%)
C2H2 Zn finger 345..365 CDD:275368 9/47 (19%)
C2H2 Zn finger 373..391 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.