DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and Rbak

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_006504786.1 Gene:Rbak MGIID:1927369 Length:846 Species:Mus musculus

Alignment Length:585 Identity:144/586 (25%)
Similarity:227/586 (39%) Gaps:117/586 (20%)


  Fly    73 LKFEMGLAKKRTLRPGAVPCVNKSQESGSDRARKERSQR-----RRNQEL-----------VAEL 121
            |:|.:.:.::.|     .|||::.....|:...::.||:     :..|.:           ||..
Mouse    92 LRFHLVVPRRET-----CPCVDQLISDFSELFLQQVSQQCLQFPQEEQNMSRSKGPLSFKDVAVA 151

  Fly   122 LAEEEAKLIHPEATSFEQDSVY--LSETVTMELDPLSGEE--KLEELQKCRTCYNDFTAD--FRA 180
            .::||.:.:.||..:..:|.:.  .|..|::..|......  |||:.::..|...|..|.  ...
Mouse   152 FSQEEWQQLDPEERTTYRDVMLETYSNLVSVGYDVTKPNMIIKLEQGEEPWTVEGDRHAQRHLEI 216

  Fly   181 KDLFDPANSVLLFHIEVISGVWISHKPDEPRLMC---PAC-----KSALDQAIDFREMCISTELK 237
            ..::||...     ||.|.         |..|.|   |.|     .:|.|:|.......||    
Mouse   217 SKVYDPREG-----IEEIG---------EKHLQCDDDPYCWRAEKGAAFDEAYTLETALIS---- 263

  Fly   238 LSQAKPSTDEVQIEAENENPISSDHDLISDTENTNVE------EIEDAGGDHVEDEATSDDQTSQ 296
                 ||:......:..|. :.|..:|||...:..:|      |...|.|:.:||....:..:||
Mouse   264 -----PSSGAHSCVSCGET-LESVSELISSDGSYALEKPSMCFECGKAYGESLEDFNQDEGNSSQ 322

  Fly   297 EAVDE-------VAESPAAQDPLSVALGAKIFKELLDQYTGKEKARLRKGAP-------IASKPK 347
            .  ||       :.|.|.|.:.:.......:|......|.|::........|       .::.|:
Mouse   323 H--DENILQKVTILEKPFAYECMEALDSESVFMARERAYMGEKPYDWGDSGPDFIQMSDFSTYPR 385

  Fly   348 AKEKAAGEQKP---KRSANPKTKEERNLI-RRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHT 408
            ::.    |.||   .:......|:.:.:| :||....||  :.|..||::|.....|.:|...|.
Mouse   386 SQM----ELKPFECTQCGKSFCKKSKFIIHQRAHTGEKP--YACSVCGKSFSQKGTLTVHRRSHL 444

  Fly   409 RTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIV 473
            ..|.|:|.||.|||........|.| .|.||.|:.|..|.::|.     ||....:|        
Mouse   445 EEKPYKCNECGKTFCQKLHLTQHQR-THSGEKPYECSECGKSFC-----QKTHLTLH-------- 495

  Fly   474 KRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEM 538
            :|.:....|       |.|..|.|.::.|.||..|.::||....|||..|.|||...:.|..|:.
Mouse   496 QRNHSGERP-------YPCNECGKSFSRKSALNDHQRTHTGEKLYKCNECGKSYYRKSTLITHQR 553

  Fly   539 THE-KRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVC----NVNFRYKYNMKSHANSKMHQ 598
            ||. ::|.||..|.|.|.:.:.|..|...|..|:||.|..|    |:|..:..:.|.||..::.:
Mouse   554 THTGEKPYQCSECGKFFSRVSYLTIHYRSHLEEKPYECTECGKTFNLNSAFIRHWKVHAEERVQE 618

  Fly   599  598
            Mouse   619  618

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206 6/23 (26%)
zf-AD 167..240 CDD:214871 18/83 (22%)
zf-C2H2 385..407 CDD:278523 6/22 (27%)
C2H2 Zn finger 387..407 CDD:275368 6/20 (30%)
zf-H2C2_2 399..422 CDD:290200 10/23 (43%)
C2H2 Zn finger 415..436 CDD:275368 8/21 (38%)
C2H2 Zn finger 444..460 CDD:275368 5/16 (31%)
C2H2 Zn finger 492..512 CDD:275368 7/20 (35%)
C2H2 Zn finger 520..540 CDD:275368 8/20 (40%)
C2H2 Zn finger 547..567 CDD:275368 6/20 (30%)
zf-met 574..597 CDD:289631 7/27 (26%)
C2H2 Zn finger 575..591 CDD:275368 5/20 (25%)
RbakXP_006504786.1 KRAB 143..203 CDD:214630 13/60 (22%)
KRAB 143..182 CDD:279668 9/39 (23%)
Extradiol_Dioxygenase_3B_like <252..>349 CDD:294399 24/109 (22%)
COG5048 386..829 CDD:227381 78/261 (30%)
C2H2 Zn finger 395..415 CDD:275368 4/20 (20%)
zf-H2C2_2 411..432 CDD:290200 8/23 (35%)
C2H2 Zn finger 423..443 CDD:275368 6/20 (30%)
zf-H2C2_2 436..458 CDD:290200 10/22 (45%)
zf-C2H2 449..471 CDD:278523 9/23 (39%)
C2H2 Zn finger 451..471 CDD:275368 8/21 (38%)
zf-H2C2_2 463..486 CDD:290200 8/24 (33%)
C2H2 Zn finger 479..499 CDD:275368 7/33 (21%)
zf-H2C2_2 491..516 CDD:290200 7/40 (18%)
C2H2 Zn finger 507..527 CDD:275368 7/20 (35%)
zf-H2C2_2 519..544 CDD:290200 12/25 (48%)
zf-C2H2 533..555 CDD:278523 10/22 (45%)
C2H2 Zn finger 535..555 CDD:275368 8/20 (40%)
zf-H2C2_2 548..572 CDD:290200 10/24 (42%)
C2H2 Zn finger 563..583 CDD:275368 6/20 (30%)
zf-H2C2_2 575..599 CDD:290200 8/24 (33%)
C2H2 Zn finger 591..611 CDD:275368 5/20 (25%)
C2H2 Zn finger 645..665 CDD:275368
C2H2 Zn finger 673..693 CDD:275368
C2H2 Zn finger 701..721 CDD:275368
zf-C2H2 701..721 CDD:278523
zf-H2C2_2 713..738 CDD:290200
C2H2 Zn finger 729..749 CDD:275368
zf-H2C2_2 741..766 CDD:290200
C2H2 Zn finger 757..777 CDD:275368
zf-H2C2_2 769..794 CDD:290200
C2H2 Zn finger 785..805 CDD:275368
zf-H2C2_2 797..822 CDD:290200
C2H2 Zn finger 813..833 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.