DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and ZNF691

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001229668.1 Gene:ZNF691 HGNCID:28028 Length:315 Species:Homo sapiens

Alignment Length:272 Identity:76/273 (28%)
Similarity:121/273 (44%) Gaps:32/273 (12%)


  Fly   341 PIASKPKAKEKAAGE------QKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHN 399
            |...|...:|..:.|      :||.:....:.:|..:.|...:..|....|:|.|||:.|..:.|
Human    65 PPGEKEHGQESLSDELQETHPKKPWQKVTVRARELGDPIAHPRHEADEKPFICAQCGKTFNNTSN 129

  Fly   400 LRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEV 464
            ||.|...||..|.|:|:||.|:|..:..|..|.|| |..|..:.|..|.|:|     |::.:...
Human   130 LRTHQRIHTGEKPYKCSECGKSFSRSSNRIRHERI-HLEEKHYKCPKCQESF-----RRRSDLTT 188

  Fly   465 HNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSD 529
            |..      ..:..:|         |:|.:|.|.::....|..|.::|.:...|.|..|.||:|:
Human   189 HQQ------DHLGKRP---------YRCDICGKSFSQSATLAVHHRTHLEPAPYICCECGKSFSN 238

  Fly   530 PNKLKRHEMTHE-KRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNM----K 589
            .:....|..||. :||.:|..|.:.|...:....|:..|.||:||.|.||..:|....|:    |
Human   239 SSSFGVHHRTHTGERPYECTECGRTFSDISNFGAHQRTHRGEKPYRCTVCGKHFSRSSNLIRHQK 303

  Fly   590 SHANSKMHQDNA 601
            :|...:..:|::
Human   304 THLGEQAGKDSS 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871
zf-C2H2 385..407 CDD:278523 10/22 (45%)
C2H2 Zn finger 387..407 CDD:275368 9/20 (45%)
zf-H2C2_2 399..422 CDD:290200 12/23 (52%)
C2H2 Zn finger 415..436 CDD:275368 9/21 (43%)
C2H2 Zn finger 444..460 CDD:275368 5/16 (31%)
C2H2 Zn finger 492..512 CDD:275368 5/20 (25%)
C2H2 Zn finger 520..540 CDD:275368 7/20 (35%)
C2H2 Zn finger 547..567 CDD:275368 4/20 (20%)
zf-met 574..597 CDD:289631 7/27 (26%)
C2H2 Zn finger 575..591 CDD:275368 6/20 (30%)
ZNF691NP_001229668.1 COG5048 <108..266 CDD:227381 54/179 (30%)
C2H2 Zn finger 117..137 CDD:275368 9/20 (45%)
C2H2 Zn finger 145..165 CDD:275368 9/21 (43%)
C2H2 Zn finger 173..193 CDD:275368 6/31 (19%)
C2H2 Zn finger 201..221 CDD:275368 5/20 (25%)
C2H2 Zn finger 229..249 CDD:275368 7/20 (35%)
C2H2 Zn finger 257..277 CDD:275368 4/20 (20%)
zf-C2H2 283..305 CDD:306579 7/22 (32%)
C2H2 Zn finger 285..305 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3304
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.