DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and trem

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_650861.1 Gene:trem FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster

Alignment Length:498 Identity:108/499 (22%)
Similarity:171/499 (34%) Gaps:164/499 (33%)


  Fly   159 EKLEELQKCRTCYND-FTADFRAKDLFDPANSVLLFH-IEVISGVWISHKPDEPRLMCPACKSAL 221
            |..|:...||.|.|: ...:....|:|....|..|.. :.:.:|:.:|...:.|..||..|...|
  Fly     4 ESNEKWVVCRVCLNNPSEGEELLHDIFSETASTRLDQMLHICAGIPVSLDDNFPDKMCSKCVRCL 68

  Fly   222 DQAIDFREMCISTELKLSQAKPSTDEVQIEAENENPISSDHDLISDTENTNVEEI----ED---- 278
            .....||..|..:...:      .|.:..||.|.| .:.:.||:|..|:.:||.:    ||    
  Fly    69 RLCYKFRLTCQRSHQHI------MDMLDREASNAN-AAGEGDLLSIAEDLSVESVLKSWEDYASQ 126

  Fly   279 -AGGDHVEDEATSDDQTSQEAVD-----------------------EVAESPAAQDPLSVALGAK 319
             .||..||.|.....|.....|:                       |.||:.|..:..       
  Fly   127 LDGGMKVEGEEDQQHQVITYVVEDGDTDDTNMFDVHDPTQPVPNEIEEAETYAEYEEY------- 184

  Fly   320 IFKELLDQYTGKEKARLR--KGAPIASKPKAKEKAAGE------------QKPKR---------- 360
               |||......|.|:.:  .|..:|::...:|:.|.:            .||::          
  Fly   185 ---ELLTNENSPEIAQEKGSTGTDVATEEPPEEEIAEDILDSDEDYDPTHAKPEKCDRSGRKPVA 246

  Fly   361 --SANPKTKEERNLIRRAQLRAKPPN----FVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECP 419
              ..:||.:..:..:.|     ||.|    ::||.||..:.....|..||..|:..|.::|..|.
  Fly   247 YHKNSPKVETFKKKVGR-----KPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICG 306

  Fly   420 KTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKP 484
            :.|                                         |.|                  
  Fly   307 RGF-----------------------------------------VQN------------------ 312

  Fly   485 RESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSD-PNKLKRHEMTHEKRPLQCD 548
            ::.||                  |:.:||....|||..|..:::| ..|.|.|.:..::||..||
  Fly   313 QQLVR------------------HMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCD 359

  Fly   549 VCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSH 591
            ||.:.|.....|:.|::|||||:|:.|::|...|...|.::.|
  Fly   360 VCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKLRLH 402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 18/75 (24%)
zf-C2H2 385..407 CDD:278523 7/22 (32%)
C2H2 Zn finger 387..407 CDD:275368 7/20 (35%)
zf-H2C2_2 399..422 CDD:290200 7/23 (30%)
C2H2 Zn finger 415..436 CDD:275368 3/21 (14%)
C2H2 Zn finger 444..460 CDD:275368 0/16 (0%)
C2H2 Zn finger 492..512 CDD:275368 1/20 (5%)
C2H2 Zn finger 520..540 CDD:275368 6/21 (29%)
C2H2 Zn finger 547..567 CDD:275368 8/20 (40%)
zf-met 574..597 CDD:289631 5/19 (26%)
C2H2 Zn finger 575..591 CDD:275368 4/16 (25%)
tremNP_650861.1 zf-AD 11..87 CDD:214871 18/82 (22%)
COG5048 <264..411 CDD:227381 50/217 (23%)
C2H2 Zn finger 274..294 CDD:275368 7/20 (35%)
zf-H2C2_2 287..311 CDD:290200 9/65 (14%)
C2H2 Zn finger 302..322 CDD:275368 8/97 (8%)
zf-H2C2_2 315..338 CDD:290200 9/41 (22%)
C2H2 Zn finger 330..350 CDD:275368 6/20 (30%)
zf-H2C2_2 345..367 CDD:290200 9/22 (41%)
C2H2 Zn finger 358..378 CDD:275368 8/20 (40%)
zf-H2C2_2 370..394 CDD:290200 11/24 (46%)
C2H2 Zn finger 386..406 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.