DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and CG4854

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster


Alignment Length:385 Identity:93/385 - (24%)
Similarity:148/385 - (38%) Gaps:89/385 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 KCRTCYNDFTADFRAKDLFDPANSVLL-------FHIEVISGVWISHKPDEPRLMCPACKSALDQ 223
            |||.|            |..|.:..|:       ..|:..:||.:|..||.|..:|.:|...|..
  Fly    11 KCRIC------------LVQPKDESLMPTEPDFPDKIKRCTGVELSESPDWPNRICTSCALLLRA 63

  Fly   224 AIDFREMCISTELKLSQAKPSTDEVQIEAENENPISSDHDLISDTENTNVEEIEDAGGD-HVEDE 287
            |:..|.:|..||..|.:.|  ..|:.||.     :..:.:....||:.::.:.|..|.| .:|.|
  Fly    64 ALKLRSLCQQTEKDLKEQK--LQEINIEI-----VHDEQETKKKTESRDLSKNEATGSDSELEYE 121

  Fly   288 ATSDDQTSQEAVDEVAESPAAQDPLSVALGAKIFKELLDQYTGKEKARLRKGAPIASKPKAKEKA 352
            .......:.|:.::||.|  |.:.:|:                         .|..|.|   |::
  Fly   122 YLDSYDVTLESSEDVACS--ADELVSI-------------------------EPAISAP---EES 156

  Fly   353 AGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTE 417
            .....||    |.|.|:.:       ..:..:|.|:.|...:.....|..||..|:..|.::|..
  Fly   157 VYSLSPK----PVTFEDED-------SGQAASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEI 210

  Fly   418 CPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMP 482
            |.|.|........|:. .|.|..|:.|.:|...||.|..|.||: .:|.          |.:|  
  Fly   211 CHKRFRQTPQLARHMN-THTGNRPYKCDYCDSRFADPSTRIKHQ-RIHT----------NERP-- 261

  Fly   483 KPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHEK 542
                   |:|:.|.:.:.....|..|:|:||....:.||.|.||:|..:....||.:|::
  Fly   262 -------YKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHEKSHKR 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 22/79 (28%)
zf-C2H2 385..407 CDD:278523 6/21 (29%)
C2H2 Zn finger 387..407 CDD:275368 5/19 (26%)
zf-H2C2_2 399..422 CDD:290200 8/22 (36%)
C2H2 Zn finger 415..436 CDD:275368 5/20 (25%)
C2H2 Zn finger 444..460 CDD:275368 6/15 (40%)
C2H2 Zn finger 492..512 CDD:275368 5/19 (26%)
C2H2 Zn finger 520..540 CDD:275368 8/19 (42%)
C2H2 Zn finger 547..567 CDD:275368
zf-met 574..597 CDD:289631
C2H2 Zn finger 575..591 CDD:275368
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 14/56 (25%)
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 193..217 CDD:290200 9/23 (39%)
COG5048 201..>258 CDD:227381 18/68 (26%)
C2H2 Zn finger 208..228 CDD:275368 5/20 (25%)
zf-H2C2_2 221..244 CDD:290200 6/23 (26%)
C2H2 Zn finger 236..256 CDD:275368 8/20 (40%)
zf-H2C2_2 251..273 CDD:290200 8/41 (20%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
zf-H2C2_2 277..301 CDD:290200 10/23 (43%)
C2H2 Zn finger 292..312 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.