DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and CG4424

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster

Alignment Length:467 Identity:106/468 (23%)
Similarity:166/468 (35%) Gaps:146/468 (31%)


  Fly   158 EEKLEELQKCRTCYNDFTAD----FRAKDLFDPANSVLLFHIEVISGVWISHKPDE---PRLMCP 215
            |.:|..:..||||..|..|.    |:..|...|....|...||.:||:.|.....|   |..:|.
  Fly     2 EIRLNMMTLCRTCLQDGEAHMVSIFQTADDRLPGGVSLCDKIESLSGIQIRATAKEEVLPTRICL 66

  Fly   216 ACKSALDQAIDFREMCISTELKLSQAKPSTDEVQIEAENENPISSDHDLISDTENTNVEEIEDAG 280
            .||:.|..|..||::|       .::.....|..|:...|..:..  :::..|..:....||...
  Fly    67 RCKAFLTLAHKFRQIC-------QRSNEFLREYVIKDAVEQGVVK--EVVQQTRPSTPPPIETEQ 122

  Fly   281 GDHVEDEATSDD-QTSQEAVDEVAESPAAQDPLSVALGAKIFKELLD-QYTGKEKARLRKGAPIA 343
            .:..|||...:. .::::.::|....||.::..:|     :..|:|. .|.          .|.:
  Fly   123 LEPPEDEVLEEGVWSTEDPIEETPHGPAEKERPTV-----LTVEMLPAPYP----------PPAS 172

  Fly   344 SKPKAKEKAAGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHT 408
            :.|.|   .||..|.|.                        .||..||..:.....|..||.||.
  Fly   173 TPPPA---PAGAVKGKL------------------------HVCAICGNGYPRKSTLDTHMRRHN 210

  Fly   409 RTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIV 473
            ..:.|:|..|.|:|:                                                  
  Fly   211 DERPYECEICHKSFH-------------------------------------------------- 225

  Fly   474 KRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEM 538
                          |.||.|.             ||:.||.|..|.||.|.::::|...|.:||.
  Fly   226 --------------VNYQLKR-------------HIRQHTGAKPYTCQYCQRNFADRTSLVKHER 263

  Fly   539 TH-EKRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANSKMHQDNAR 602
            || .:||..|..|.|.|...:.|:.|...||||:|:.|::||.:|...:|:.:|..::.|.::.|
  Fly   264 THRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHLQTQQHINDPR 328

  Fly   603 --------KLGV 606
                    |:|:
  Fly   329 LTAYLSTFKVGI 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 25/80 (31%)
zf-C2H2 385..407 CDD:278523 8/22 (36%)
C2H2 Zn finger 387..407 CDD:275368 7/20 (35%)
zf-H2C2_2 399..422 CDD:290200 9/23 (39%)
C2H2 Zn finger 415..436 CDD:275368 4/21 (19%)
C2H2 Zn finger 444..460 CDD:275368 0/16 (0%)
C2H2 Zn finger 492..512 CDD:275368 3/20 (15%)
C2H2 Zn finger 520..540 CDD:275368 8/20 (40%)
C2H2 Zn finger 547..567 CDD:275368 6/20 (30%)
zf-met 574..597 CDD:289631 6/23 (26%)
C2H2 Zn finger 575..591 CDD:275368 5/16 (31%)
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 26/89 (29%)
C2H2 Zn finger 189..209 CDD:275368 7/20 (35%)
DUF45 <204..281 CDD:302795 34/154 (22%)
COG5048 210..>345 CDD:227381 47/209 (22%)
C2H2 Zn finger 217..237 CDD:275368 10/97 (10%)
C2H2 Zn finger 245..265 CDD:275368 8/20 (40%)
zf-H2C2_2 257..282 CDD:290200 11/25 (44%)
C2H2 Zn finger 273..293 CDD:275368 6/20 (30%)
zf-H2C2_2 286..310 CDD:290200 11/24 (46%)
C2H2 Zn finger 301..320 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.