DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and Odj

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_650661.1 Gene:Odj FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster

Alignment Length:399 Identity:112/400 (28%)
Similarity:177/400 (44%) Gaps:74/400 (19%)


  Fly   166 KCRTC-YNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQAIDFRE 229
            :||.| ...||.  ..|::|:..|..:...||.|:|:.|..:...|:.:|..|...|.||:.||:
  Fly     4 ECRICGERIFTP--HPKNIFEKRNHRIRMAIEQITGLEIVLENMLPQHICACCLLDLTQAVAFRQ 66

  Fly   230 MCISTELKLSQAKPSTDEVQIEAENE-NPISSD----HDLISDTENT--NVEEIEDAGGDHVEDE 287
            .|:.|...|.|...|...|..:...| :|:.||    .:::.||.:|  :.|.::|      :.:
  Fly    67 RCLETHANLHQRISSKAGVASKGSPEVSPVLSDPLLKREVLDDTVDTEDDKELLDD------DKD 125

  Fly   288 ATSDDQTSQEAVDEVAESPAAQDPLSVALGAKIFKELLDQ-YTGKEKARL---RKGAPIASK--- 345
            ...||:...|....:...|.|:         ||  .:.|| :..::..|:   |...|:..|   
  Fly   126 LMDDDKDFLEDEKPILRYPPAK---------KI--RIEDQNFPNRQSPRVRVKRLRVPVVEKADS 179

  Fly   346 --PKAKEKAAGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHT 408
              |..:|..   :|| |...||.|.:|::.|          :||||||.:|....|::.|.|||.
  Fly   180 PPPPPREHV---RKP-RKRRPKPKVDRSIKR----------YVCDQCGWSFNDHSNMKDHKLRHF 230

  Fly   409 RTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIV 473
            ..| :.|.||.:.||...:..:|||:.|:||.|:.|.||...||...:|.:||.::|  |..|: 
  Fly   231 EEK-FSCDECGRKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMH--ANELV- 291

  Fly   474 KRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSH--TDANAYKCQRCSKSYSDPNKLKRH 536
                            :.||:|.|.:.|:.....|.:.|  ...:.:.|..|:|.:.:...|.||
  Fly   292 ----------------HPCKICGKRFNSEKGRLKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRH 340

  Fly   537 EMT--HEKR 543
            ..|  |.||
  Fly   341 YSTKYHRKR 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 24/74 (32%)
zf-C2H2 385..407 CDD:278523 11/22 (50%)
C2H2 Zn finger 387..407 CDD:275368 10/20 (50%)
zf-H2C2_2 399..422 CDD:290200 9/23 (39%)
C2H2 Zn finger 415..436 CDD:275368 8/21 (38%)
C2H2 Zn finger 444..460 CDD:275368 6/16 (38%)
C2H2 Zn finger 492..512 CDD:275368 6/20 (30%)
C2H2 Zn finger 520..540 CDD:275368 7/22 (32%)
C2H2 Zn finger 547..567 CDD:275368
zf-met 574..597 CDD:289631
C2H2 Zn finger 575..591 CDD:275368
OdjNP_650661.1 zf-AD 5..77 CDD:214871 24/74 (32%)
COG5048 <202..343 CDD:227381 51/171 (30%)
C2H2 Zn finger 209..229 CDD:275368 10/20 (50%)
C2H2 Zn finger 236..256 CDD:275368 8/20 (40%)
zf-H2C2_2 249..274 CDD:290200 12/25 (48%)
C2H2 Zn finger 265..283 CDD:275368 8/18 (44%)
C2H2 Zn finger 298..314 CDD:275368 3/16 (19%)
zf-C2H2_jaz 322..347 CDD:288983 8/25 (32%)
C2H2 Zn finger 324..343 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.