DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and CG17802

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_650659.2 Gene:CG17802 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster

Alignment Length:510 Identity:132/511 (26%)
Similarity:205/511 (40%) Gaps:166/511 (32%)


  Fly   166 KCRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQAIDFREM 230
            :||.| .|........::|| .||.::..|.:::|:|::.....||.||..|..:|..||.||:.
  Fly     4 QCRLC-GDLIYTQNPVNIFD-ENSKMVRQIALVTGLWLTDHSKMPRNMCSCCLLSLKSAIAFRQA 66

  Fly   231 CISTELKLS------QAK-------PSTD----------EVQIE-------AENENPISSDHDLI 265
            ||.|..:|:      :||       |.:|          ||:.|       |:||. :..||||.
  Fly    67 CIKTNNRLTIQRRSVEAKDDGCWADPLSDAHEGLKINDAEVEQEVLYEVSYADNEG-LEEDHDLY 130

  Fly   266 --------------------------SDTENTNVEEIED-----AGGDHVE-----DEATSDDQT 294
                                      .|.|....:|.||     .|.|..|     :|:..|::.
  Fly   131 KKEEEESEVNENKEFEDIACEIPFSKEDDEQEQQQEYEDMVDKKTGHDDGEESQECEESQPDEEE 195

  Fly   295 SQEAVDEVAESPAAQDPLSVALGAKIFKELLDQYTGKEKARLRKGAPI--ASKPKAKEKAAGEQK 357
            ||:..::..||....|            ||.....|.........:.|  .|:..|.::   ::|
  Fly   196 SQQNEEDEEESQEDDD------------ELWQNEDGDSDTDADSMSDIEATSRQSALDE---DKK 245

  Fly   358 PKRS----ANPKTKEERNLIRRAQLRAK----PPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQ 414
            |:|.    ::|| .::.:.::.|:.:.|    ....:||.||:.|....|..:|:|||:..|.::
  Fly   246 PRRKYTKRSSPK-NDDTDFLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFE 309

  Fly   415 CTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPK 479
            |.||.:..::.|:.|:|||::||||.|:||.||.|.|.:...|.:||:.||           ..|
  Fly   310 CPECGQKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVH-----------RNK 363

  Fly   480 PMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHEKRP 544
            ..||     .::|..|.|.|.|.                                          
  Fly   364 KTPK-----NFKCNYCDKRYESN------------------------------------------ 381

  Fly   545 LQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANSKMHQD 599
                      |||.:   ||::|||||.:.||||.|:|....|:|:|..|:.||:
  Fly   382 ----------YQRAK---HEVVHTGERNFHCEVCKVSFTRNSNLKTHYRSRQHQN 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 25/79 (32%)
zf-C2H2 385..407 CDD:278523 9/22 (41%)
C2H2 Zn finger 387..407 CDD:275368 9/20 (45%)
zf-H2C2_2 399..422 CDD:290200 9/23 (39%)
C2H2 Zn finger 415..436 CDD:275368 8/21 (38%)
C2H2 Zn finger 444..460 CDD:275368 6/16 (38%)
C2H2 Zn finger 492..512 CDD:275368 5/20 (25%)
C2H2 Zn finger 520..540 CDD:275368 0/20 (0%)
C2H2 Zn finger 547..567 CDD:275368 5/20 (25%)
zf-met 574..597 CDD:289631 10/23 (43%)
C2H2 Zn finger 575..591 CDD:275368 8/16 (50%)
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 24/72 (33%)
C2H2 Zn finger 282..302 CDD:275368 9/20 (45%)
C2H2 Zn finger 310..331 CDD:275368 8/21 (38%)
C2H2 Zn finger 339..360 CDD:275368 9/21 (43%)
C2H2 Zn finger 371..388 CDD:275370 9/72 (13%)
zf-met 398..421 CDD:289631 10/23 (43%)
C2H2 Zn finger 399..417 CDD:275368 9/18 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.