DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and CG17803

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001303488.1 Gene:CG17803 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster

Alignment Length:576 Identity:185/577 (32%)
Similarity:290/577 (50%) Gaps:114/577 (20%)


  Fly    94 NKSQESGSDRARKERSQRRRNQELVAELLAEEEAKLIHPEAT-------------------SFEQ 139
            :|.....:|.....||.|:.|::||...|||.:    ..:||                   .||:
  Fly    10 SKWVRQSNDNKDTMRSSRQVNKKLVKLFLAEAD----DSDATCTTSTALDTTTADSAFFDSDFEE 70

  Fly   140 DSVYLSETVTMELDPLSGEEKLEELQKCRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWIS 204
            :|     |...|.||       ....|||||:...:....|:||:|..|..||.||:||:||||.
  Fly    71 ES-----TGLQECDP-------PPASKCRTCFRIISRHEDAQDLYDRVNIALLHHIKVITGVWIQ 123

  Fly   205 HKPDE-PRLMCPACKSALDQAIDFREMCISTELKLSQAKPSTDEVQIEAENENPISSDHDLISDT 268
            ....| |..:|..|:..::::::||..|...:.||.|   :|::..|:.       .|.::.|:.
  Fly   124 QGVKELPHHICSTCQETVNKSMEFRAKCQQVDKKLRQ---TTEKYNIQI-------CDEEMESEL 178

  Fly   269 ENTNVEE------------------IEDAGGDHVEDEATSDDQTSQEAVDE-------------- 301
            ||...||                  :.|:.|...||:...|.:.:|.::.|              
  Fly   179 ENVLYEESAQQAKGVVGLEDFSSELLPDSEGVLDEDDFPLDAEPTQFSLSEDELDLDRDTEKDFA 243

  Fly   302 VAESPAAQDPLSVAL------------GAKIFKELLDQYTGKEKARLRKGAP--IASKPKAKEKA 352
            :.::.:..:.:|:..            |||::|.:|.:|..     |::.||  ..|.||     
  Fly   244 LEQNKSCNEIISIRKCKTKEEIGKVDHGAKVYKVVLGEYNS-----LKETAPKYSLSLPK----- 298

  Fly   353 AGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTE 417
                ||:...:|   ||:|..||.:::|||.|:|||:||..||....|::|:|||.|.||::|.|
  Fly   299 ----KPQLRVSP---EEKNRRRRERIQAKPLNYVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPE 356

  Fly   418 CPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMP 482
            |||.|||.|.||:|:|..|:||.||.|..|:|:||...:|.:||.:||.|.     .||..:...
  Fly   357 CPKKFYDLYTRNIHVRALHKGEHPFPCNHCNESFANASSRHRHERDVHGAG-----NRIRTRVKS 416

  Fly   483 KPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHEKRPLQC 547
            |...|.|:.|..|.|.|.||..|..|:..|..:..::|:.|...::||:.:|||:..|:|.|::|
  Fly   417 KEEGSSRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQALHDKFPIRC 481

  Fly   548 DVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANSKMHQDNARK 603
            |:|||||..|::|.:|:.:|||..|:.||:|:|::|::||:..|.|:.:|:||.:|
  Fly   482 DICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTDLHRDNMQK 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206 1/2 (50%)
zf-AD 167..240 CDD:214871 28/74 (38%)
zf-C2H2 385..407 CDD:278523 11/22 (50%)
C2H2 Zn finger 387..407 CDD:275368 10/20 (50%)
zf-H2C2_2 399..422 CDD:290200 13/23 (57%)
C2H2 Zn finger 415..436 CDD:275368 13/21 (62%)
C2H2 Zn finger 444..460 CDD:275368 6/16 (38%)
C2H2 Zn finger 492..512 CDD:275368 8/20 (40%)
C2H2 Zn finger 520..540 CDD:275368 7/20 (35%)
C2H2 Zn finger 547..567 CDD:275368 10/20 (50%)
zf-met 574..597 CDD:289631 9/23 (39%)
C2H2 Zn finger 575..591 CDD:275368 7/16 (44%)
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 28/74 (38%)
COG5048 <323..528 CDD:227381 92/210 (44%)
zf-C2H2 324..346 CDD:278523 11/22 (50%)
C2H2 Zn finger 326..346 CDD:275368 10/20 (50%)
C2H2 Zn finger 354..375 CDD:275368 13/21 (62%)
C2H2 Zn finger 383..401 CDD:275368 8/18 (44%)
C2H2 Zn finger 426..446 CDD:275368 8/20 (40%)
C2H2 Zn finger 454..474 CDD:275368 7/20 (35%)
C2H2 Zn finger 481..501 CDD:275368 10/20 (50%)
C2H2 Zn finger 509..528 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BQ0F
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.