DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and CG6813

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster

Alignment Length:445 Identity:99/446 (22%)
Similarity:139/446 (31%) Gaps:170/446 (38%)


  Fly   167 CRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQAIDFREMC 231
            ||.|    :......|||.|.|..|:..|..|:||.:|.|.:....||..|...|..||.||:.|
  Fly     6 CRIC----SRSDAPIDLFGPGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQRC 66

  Fly   232 ISTELKLSQAKPSTDEVQIEAENENPISSDHDLISDTENTNVEEIE----DAGGDHVEDEATSDD 292
            |.                                  .|..|:|.||    |...|.:..|...|:
  Fly    67 II----------------------------------AEKQNLERIECDSKDCSTDPIIYEDIDDN 97

  Fly   293 QTSQEAVDEVAESPAAQD-PLSVALGAKIFKELLDQYTGKEKARLRKGAPIASKPKAKEKAAGEQ 356
            |...| :||....|..:| |:                            |.|.|..|......::
  Fly    98 QIESE-LDESILCPEVKDLPM----------------------------PSAEKVSAPTSLNHQK 133

  Fly   357 KPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCT--ECP 419
            .......|                    :||..||:......|.:.|.||||..||:.|.  .|.
  Fly   134 SIGGGTGP--------------------YVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCE 178

  Fly   420 KTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKP 484
            ::|........|.|| |.||.|:.|.:|...|:..||||:|.                       
  Fly   179 RSFATRKELTSHTRI-HTGEQPYVCVYCPRRFSSSGARQEHH----------------------- 219

  Fly   485 RESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHEKRPLQCDV 549
                                                             :||   ..:|..:||.
  Fly   220 -------------------------------------------------RRH---RNERRYECDT 232

  Fly   550 CLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANSKMHQDNARKL 604
            |.|.|.....||:|::||...|.::|.||..:|:...::.:|.:|.:|:....||
  Fly   233 CKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIHKRKEEKL 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 25/73 (34%)
zf-C2H2 385..407 CDD:278523 8/22 (36%)
C2H2 Zn finger 387..407 CDD:275368 7/20 (35%)
zf-H2C2_2 399..422 CDD:290200 10/25 (40%)
C2H2 Zn finger 415..436 CDD:275368 6/23 (26%)
C2H2 Zn finger 444..460 CDD:275368 7/16 (44%)
C2H2 Zn finger 492..512 CDD:275368 0/20 (0%)
C2H2 Zn finger 520..540 CDD:275368 2/20 (10%)
C2H2 Zn finger 547..567 CDD:275368 9/20 (45%)
zf-met 574..597 CDD:289631 6/23 (26%)
C2H2 Zn finger 575..591 CDD:275368 4/16 (25%)
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 28/108 (26%)
C2H2 Zn finger 144..164 CDD:275368 7/20 (35%)
C2H2 Zn finger 172..194 CDD:275368 6/23 (26%)
zf-H2C2_2 186..211 CDD:290200 10/26 (38%)
UFD2 <256..>294 CDD:227443 9/33 (27%)
C2H2 Zn finger 258..280 CDD:275368 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.