DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and CG14711

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster


Alignment Length:468 Identity:112/468 - (23%)
Similarity:175/468 - (37%) Gaps:135/468 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 LEELQKCRTCYNDFTADFRAK---DLFDPANS---VLLFHIEVISGVWISHKPDEPRLMCPACKS 219
            :.|...||.|   .|.|..::   .|||..::   .|:..||.:..:.:....:.|.::|.:|..
  Fly     1 MPEYMLCRIC---LTEDINSEAMAPLFDDNDAQCRELVRKIEEVGSIKLVPLQNIPSMLCYSCVE 62

  Fly   220 ALDQAIDFREMCISTE-------LKLSQAKPSTDEV-QIEAEN-ENPISSDHDLISDTENTNVEE 275
            .|..|..|||:|..:|       :|.......|||| .:.|:| |....|.:|.|...|      
  Fly    63 RLTSAHKFRELCQESERTFATNVVKAEMKSEPTDEVPHVVADNIEYIYESANDFIDGVE------ 121

  Fly   276 IEDAGGDHVEDEATSD--DQTSQ-----EAVDEVAES----PAAQDPLSVALGAKIFKELLDQYT 329
             :|.|.:::.:|...|  .:|||     ..||::.|.    |.:.|               ..|.
  Fly   122 -DDIGMENIMEEPLEDGVGETSQAYETSTVVDDLDEDDLLVPNSTD---------------SDYQ 170

  Fly   330 GKEKARLRKGAPIASKPKAKEKAAGEQKPKRSANPKTKEERNLIRRAQLRAKP----PNFVCDQC 390
            ..|:.|..|    ..|.:..::..|..:...|.:|::..|.....:|..::.|    .|.:|:.|
  Fly   171 PIERCRKAK----VRKTRMTKRGRGRPRGASSGHPRSFSEERPPVQASFKSSPEVSSTNIMCEIC 231

  Fly   391 GQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPG 455
            |..:.....|.|||.||...|.::|..|.|:|......|.|||: |.||.||.|.:|:.:||...
  Fly   232 GNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRV-HTGEKPFLCKYCNRSFADRS 295

  Fly   456 ARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKC 520
            :..:||                                                ::||:...:.|
  Fly   296 SNIRHE------------------------------------------------RTHTNERPFTC 312

  Fly   521 QRCSKSYSDPNKLKRHEMTHEKRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYK 585
            ..|.|::|..|.||.|.:|                           ||||:|:.|.|||..|..|
  Fly   313 STCGKAFSYSNVLKNHMLT---------------------------HTGEKPFLCRVCNKTFSRK 350

  Fly   586 YNMKSHANSKMHQ 598
            :.:..|..:..||
  Fly   351 HQLDQHLGTMTHQ 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 22/85 (26%)
zf-C2H2 385..407 CDD:278523 7/21 (33%)
C2H2 Zn finger 387..407 CDD:275368 7/19 (37%)
zf-H2C2_2 399..422 CDD:290200 10/22 (45%)
C2H2 Zn finger 415..436 CDD:275368 8/20 (40%)
C2H2 Zn finger 444..460 CDD:275368 4/15 (27%)
C2H2 Zn finger 492..512 CDD:275368 0/19 (0%)
C2H2 Zn finger 520..540 CDD:275368 8/19 (42%)
C2H2 Zn finger 547..567 CDD:275368 0/19 (0%)
zf-met 574..597 CDD:289631 7/22 (32%)
C2H2 Zn finger 575..591 CDD:275368 6/15 (40%)
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 21/77 (27%)
C2H2 Zn finger 228..248 CDD:275368 7/19 (37%)
zf-H2C2_2 240..264 CDD:290200 10/23 (43%)
COG5048 249..>362 CDD:227381 43/188 (23%)
C2H2 Zn finger 256..276 CDD:275368 8/20 (40%)
zf-H2C2_2 268..292 CDD:290200 11/24 (46%)
C2H2 Zn finger 284..304 CDD:275368 6/67 (9%)
zf-H2C2_2 299..321 CDD:290200 7/69 (10%)
C2H2 Zn finger 312..332 CDD:275368 9/46 (20%)
zf-H2C2_2 325..349 CDD:290200 14/50 (28%)
C2H2 Zn finger 340..362 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.