DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and CG6808

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001247055.1 Gene:CG6808 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster

Alignment Length:430 Identity:102/431 (24%)
Similarity:150/431 (35%) Gaps:134/431 (31%)


  Fly   167 CRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPDE--PRLMCPACKSALDQAIDFRE 229
            ||||....|.. ..:.||: :|:    |..:||....|.|||:  |..:|..|...|::...|..
  Fly    10 CRTCRKKGTQS-TLQSLFE-SNA----HKLLISYAGTSVKPDDGLPDQICTVCLMQLEEVDRFLS 68

  Fly   230 MCISTELKLSQAKPST-----------DEVQIEAE-------------NENPIS----------- 259
            .|..::..|......|           |:.|:|.:             .||||:           
  Fly    69 ACKQSDAHLRSLVRQTLSSASAFETLEDKDQLEQKKRARKQNISGRLIEENPINFKTQENALETT 133

  Fly   260 ----------SDHDLISDTENTNVEEIEDAGGDHVEDEATSDDQTSQEAVDE------VAESPAA 308
                      ...|.:.|. |.|.|..:|.   |.||...||....:|..|:      ..||.||
  Fly   134 KDDEILPINKFSSDFVFDL-NVNAENEKDI---HQEDYTISDMDLDREISDQNYSETYSQESSAA 194

  Fly   309 QDPLSVALGAKIFKELLDQYTGKEKARLRKGAPIASKPKAKEKAAGEQKPKRSANPKTKEERNLI 373
            .|.:         :|..:.|...|             |.|                      :.:
  Fly   195 TDSI---------QETSEDYHNLE-------------PSA----------------------DYV 215

  Fly   374 RRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRG 438
            ....:..:|..:.|..|...:|....|..|...|.:.|::||..|.|||..|.....|:| .|.|
  Fly   216 IDLGVACEPDKYRCKICSNTYRCLSQLNAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMR-THTG 279

  Fly   439 ETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKY 503
            |.|:.|.:||..||.....:||| .:|.          |.:|         |.|.:|.|.::...
  Fly   280 EKPYQCCYCSRRFADNSTHRKHE-RLHT----------NERP---------YACNICGKTFSLSS 324

  Fly   504 ALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMT-HEK 542
            :...|...|:...::||..|.|.:    :|| |::| |||
  Fly   325 SRNAHYYLHSSEKSHKCLMCKKEF----RLK-HQLTAHEK 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 22/75 (29%)
zf-C2H2 385..407 CDD:278523 5/22 (23%)
C2H2 Zn finger 387..407 CDD:275368 5/20 (25%)
zf-H2C2_2 399..422 CDD:290200 9/23 (39%)
C2H2 Zn finger 415..436 CDD:275368 8/21 (38%)
C2H2 Zn finger 444..460 CDD:275368 6/16 (38%)
C2H2 Zn finger 492..512 CDD:275368 4/20 (20%)
C2H2 Zn finger 520..540 CDD:275368 7/21 (33%)
C2H2 Zn finger 547..567 CDD:275368
zf-met 574..597 CDD:289631
C2H2 Zn finger 575..591 CDD:275368
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871 22/75 (29%)
C2H2 Zn finger 229..249 CDD:275368 5/20 (25%)
zf-C2H2 255..277 CDD:278523 9/23 (39%)
C2H2 Zn finger 257..277 CDD:275368 8/21 (38%)
zf-H2C2_2 269..293 CDD:290200 10/25 (40%)
C2H2 Zn finger 285..305 CDD:275368 8/21 (38%)
zf-H2C2_2 299..321 CDD:290200 10/42 (24%)
C2H2 Zn finger 313..333 CDD:275368 4/20 (20%)
C2H2 Zn finger 341..359 CDD:275368 9/23 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3304
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.