DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and CG14710

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster

Alignment Length:439 Identity:107/440 (24%)
Similarity:161/440 (37%) Gaps:97/440 (22%)


  Fly   161 LEELQKCRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQAI 225
            |..:.:||.|..||..........|...|.|...:|:...:.:...|..|...|.:|...:....
  Fly     4 LPVILQCRICLGDFEESQMICLFGDKGESDLRKKLELCCRIRVRQSPQLPEKACNSCCEFVQMWF 68

  Fly   226 DFREMCISTEL---KLSQAKPSTDEVQIEAENENPISSDHDLISDTENTNVEEIE--DAGGDHVE 285
            :||:||:::::   ..|..:|.......:||....:..:..|...|||...|||.  :.|.:..|
  Fly    69 NFRQMCLNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKEEITAIEEGDEQQE 133

  Fly   286 DEATSDDQTSQEAVD----------EVAESPAAQDPLSVALG-------AKIFKELLD------- 326
            |:       |||.:|          |..|.|..:.|..:.:.       .:..:||:|       
  Fly   134 DQ-------SQEVLDFNGFIINESIEEDEEPNTESPEQILISHMDSYVDDQQMEELIDDKGELVE 191

  Fly   327 -----------QYTGKEKARLRKGAPIASKPKAKEKAAGEQKP--------------KRSANPKT 366
                       :|..:|.......:|..|....|:|....:||              :|...||.
  Fly   192 ELSNANTFYEVEYGDEELLMSSAPSPHPSFKMDKQKPGRPRKPDAELKFKRKDINAKERGNQPKC 256

  Fly   367 KEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMH 431
            |||.             .|:|..||..|........||:.|:..|.:||..|.|:|........|
  Fly   257 KEEE-------------KFMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAH 308

  Fly   432 IRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQ 496
            || ||.|:.|:.|.:|...|.....|.:|| .||.          |.:|         |.|:.|.
  Fly   309 IR-RHTGDRPYKCMYCDRHFYDRSERVRHE-RVHT----------NTRP---------YACQECG 352

  Fly   497 KHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRH--EMTHEKR 543
            |.:.....|..||.||:....|.|..|.||::..::||.|  .:||..:
  Fly   353 KTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKAHLQTLTHRNK 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 18/76 (24%)
zf-C2H2 385..407 CDD:278523 7/22 (32%)
C2H2 Zn finger 387..407 CDD:275368 6/20 (30%)
zf-H2C2_2 399..422 CDD:290200 8/23 (35%)
C2H2 Zn finger 415..436 CDD:275368 8/21 (38%)
C2H2 Zn finger 444..460 CDD:275368 4/16 (25%)
C2H2 Zn finger 492..512 CDD:275368 7/20 (35%)
C2H2 Zn finger 520..540 CDD:275368 8/22 (36%)
C2H2 Zn finger 547..567 CDD:275368
zf-met 574..597 CDD:289631
C2H2 Zn finger 575..591 CDD:275368
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 17/74 (23%)
COG5048 <261..395 CDD:227381 48/155 (31%)
C2H2 Zn finger 264..284 CDD:275368 6/20 (30%)
zf-C2H2 290..312 CDD:278523 9/23 (39%)
C2H2 Zn finger 292..312 CDD:275368 8/21 (38%)
zf-H2C2_2 304..327 CDD:290200 9/24 (38%)
C2H2 Zn finger 320..340 CDD:275368 7/21 (33%)
zf-H2C2_2 335..357 CDD:290200 10/42 (24%)
C2H2 Zn finger 348..368 CDD:275368 7/20 (35%)
C2H2 Zn finger 376..395 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.