DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and CG4820

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001097748.1 Gene:CG4820 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster

Alignment Length:472 Identity:107/473 (23%)
Similarity:170/473 (36%) Gaps:161/473 (34%)


  Fly   167 CRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQAIDFREMC 231
            ||||.....|| ....:|.||...||..:..|:..|:.:..|.|..:|..|:..|.|...||..|
  Fly     5 CRTCGKTVVAD-ECLQIFTPAGRKLLQCVRSITNCWLQNVQDLPNHICTDCQVLLSQVQKFRRRC 68

  Fly   232 ISTE---------LKLSQAKPSTDEVQI-EAENENPISSDHDLISDTENTNVEEIEDAGGDHVED 286
            ...|         :.|.:|..:.::::: :|...:|:..| :|:| ..:..:|.|          
  Fly    69 AKIEKYFARRRRRMNLGEAPAAMEQLRVQQAAAPDPLGID-ELMS-ASDIKIEPI---------- 121

  Fly   287 EATSDDQTSQEAVDEVAESPAAQDPLSVAL------GAKIFKELLDQY---------TGKEKA-- 334
                     |..::|..::|..::.|..||      |..|. .|.:.|         |..|.|  
  Fly   122 ---------QLQMEEDPQAPYPENQLEQALSYGNAPGEDIL-PLPEDYGEAQTEVATTTNEPAQR 176

  Fly   335 RLRKGAPIASKPKAKE--------KAAGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCG 391
            |.:..|.|.||.....        |...:::|||           ::.|....|||  .:|:.||
  Fly   177 RSKNTAKIKSKKHTMRVGRKLIHVKVIDDKQPKR-----------IVDRNGPSAKP--CICEHCG 228

  Fly   392 QAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGA 456
            :.|:.:.||.:|:||||.||.::|.:|.:..|..::...| :::|. |.|:||.||...::...:
  Fly   229 RQFKDTSNLHVHLLRHTGTKPFECDQCHQKCYTLHLLRRH-QLKHT-EGPYACTFCGLEYSTNSS 291

  Fly   457 RQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQ 521
            |.:||.|                                                          
  Fly   292 RVRHERE---------------------------------------------------------- 298

  Fly   522 RCSKSYSDPNKLKRHEMTHEKRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKY 586
                                       .|.||   |....:.|:|..|||.:.||||::.|....
  Fly   299 ---------------------------ACKKG---RAPQSKWEIIKKGERTFHCEVCDLWFLRAG 333

  Fly   587 NMKSHANSKMHQDNARK 603
            |...|.||..|.:|.|:
  Fly   334 NFTQHINSSSHIENERR 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 24/82 (29%)
zf-C2H2 385..407 CDD:278523 9/22 (41%)
C2H2 Zn finger 387..407 CDD:275368 9/20 (45%)
zf-H2C2_2 399..422 CDD:290200 11/23 (48%)
C2H2 Zn finger 415..436 CDD:275368 4/21 (19%)
C2H2 Zn finger 444..460 CDD:275368 4/16 (25%)
C2H2 Zn finger 492..512 CDD:275368 0/20 (0%)
C2H2 Zn finger 520..540 CDD:275368 0/20 (0%)
C2H2 Zn finger 547..567 CDD:275368 6/20 (30%)
zf-met 574..597 CDD:289631 9/23 (39%)
C2H2 Zn finger 575..591 CDD:275368 6/16 (38%)
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071 23/71 (32%)
C2H2 Zn finger 224..244 CDD:275368 9/20 (45%)
C2H2 Zn finger 252..272 CDD:275368 4/21 (19%)
C2H2 Zn finger 279..297 CDD:275368 6/18 (33%)
C2H2 Zn finger 322..339 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.