DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and nom

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster

Alignment Length:452 Identity:100/453 (22%)
Similarity:149/453 (33%) Gaps:151/453 (33%)


  Fly   167 CRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQAIDFREMC 231
            ||.|....... :|.:||.|....:|..|::|:|:.:...|:.|.::|..|::.|..|:.||..|
  Fly     6 CRVCGRSRLCP-KAVELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIFRRQC 69

  Fly   232 ISTELK---LSQAKPSTDEVQIEAENENPISSDHDLISDTENTNVEEIEDAGGDHVEDEATSDDQ 293
            |..:.|   |.|:                     |.:..:|...||              .:|..
  Fly    70 ILQQKKWVPLLQS---------------------DKVGASEEKKVE--------------PNDPS 99

  Fly   294 TSQEAVDEVAESPAAQDPLSVALGAKIFKELLDQYTGKEKARLRKGAPIASKPKAKEKAAGEQ-- 356
            |.::........|  :.||          |::|.....|           ||..|.|...|::  
  Fly   100 TKKKTTKRRRGRP--RMPL----------EIVDIVVTNE-----------SKASAGESVGGDEFD 141

  Fly   357 -------KPKRSANPKTKEERNLIRRAQLRAKP--PN---FVCDQCGQAFRMSHNLRIHMLRHTR 409
                   :|..:.:....||.:|.....|.:..  ||   ..||.||.......:|..|...|..
  Fly   142 QPVEISNEPDATDSDVNLEEIDLPDEDGLESDHDLPNVQIHKCDTCGIIKNNKSSLVRHQFEHNG 206

  Fly   410 TKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVK 474
            .:.|.|.||||||..|.....|....|..|.||||.:|...:.....|:|||             
  Fly   207 IRPYPCKECPKTFLVASELKAHNLTHHTLEPPFACRYCDRRYFSVVGRKKHE------------- 258

  Fly   475 RINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMT 539
                                               :.||:                         
  Fly   259 -----------------------------------RVHTN------------------------- 263

  Fly   540 HEKRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANSKMHQDNA 601
              :||..||.|.|.|.:...|:.|..:|...|.|.|:||:.:|..|.::.:|..|..|:.||
  Fly   264 --ERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLATHFISNTHKRNA 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 23/76 (30%)
zf-C2H2 385..407 CDD:278523 6/22 (27%)
C2H2 Zn finger 387..407 CDD:275368 6/20 (30%)
zf-H2C2_2 399..422 CDD:290200 10/23 (43%)
C2H2 Zn finger 415..436 CDD:275368 9/21 (43%)
C2H2 Zn finger 444..460 CDD:275368 4/16 (25%)
C2H2 Zn finger 492..512 CDD:275368 0/20 (0%)
C2H2 Zn finger 520..540 CDD:275368 0/20 (0%)
C2H2 Zn finger 547..567 CDD:275368 7/20 (35%)
zf-met 574..597 CDD:289631 7/23 (30%)
C2H2 Zn finger 575..591 CDD:275368 5/16 (31%)
nomNP_001262384.1 zf-AD 5..76 CDD:214871 22/71 (31%)
C2H2 Zn finger 184..204 CDD:275368 6/20 (30%)
C2H2 Zn finger 212..261 CDD:275368 20/97 (21%)
zf-H2C2_2 255..278 CDD:290200 12/98 (12%)
C2H2 Zn finger 269..289 CDD:275368 7/20 (35%)
zf-H2C2_2 282..305 CDD:290200 9/23 (39%)
C2H2 Zn finger 297..313 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.