DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and CG7372

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_648789.3 Gene:CG7372 FlyBaseID:FBgn0036522 Length:971 Species:Drosophila melanogaster

Alignment Length:680 Identity:146/681 (21%)
Similarity:241/681 (35%) Gaps:183/681 (27%)


  Fly    59 ICIEHFKDEDIEGSLKFEMGLAKKRTLRPGAV--------------PCVN--------------- 94
            |...||:.|.:|.| |.:.|..|.....|...              ||..               
  Fly   172 ILSRHFQLEHVEKS-KRKRGKTKAAAEEPMVTPPLIIDPLEMGQLKPCAQLLVQGESVLQLCLAC 235

  Fly    95 KSQESGSDRARKERSQRRRNQELVAELLAEEE-------AKLIHPEATSFEQDSVYLS------E 146
            .||.....|.::..||:....:|   |:.:||       |.:..|.|.:..:.:..|.      |
  Fly   236 NSQFVDVVRFQEHLSQQHGYFQL---LVPKEEPTDLPPHAMVTIPGALALNKANAQLQLPIPAPE 297

  Fly   147 TVTMELD-----PLSGEEKLEELQKCRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHK 206
            |...|.|     |.:.....|:|    |..||..|...|:.:...::|.:   .::|..:.:..|
  Fly   298 TPPPEQDGKEAPPSNASNDKEDL----TMINDMVAVIAAERVKKTSSSKV---NKMIIKLPMPKK 355

  Fly   207 PDEPRLMCPACKSALDQA--IDFREMCISTE-----LKLSQAKPSTDEVQIEAENENPI------ 258
            ....|....:.:...|.|  .|.::.....|     |:..|||.::::.:..|...|.:      
  Fly   356 RGRKRTKPESLRDEQDNAEKTDKKKKLNKEEGQQPVLEPLQAKKTSNQAENGATQSNNVVKVQQN 420

  Fly   259 ----SSDHDLISDTENTNVEEIEDA---GGDHVE---------------DEA-----TSDDQTSQ 296
                ..|....:....||.:.:|:|   ..|:.|               |||     ..||.::|
  Fly   421 AKGSKKDGTQSAQKSETNPKHLENAETNSKDNTESVALKETIHDKQLTIDEAGKAGTQKDDNSNQ 485

  Fly   297 EAVDEVAESPAA----------QDPLSVALGAKIFKELLDQYTGKEKARL----RKG-----API 342
            :.:|: :|:.|.          |.|:.   .||..:::.::.|...|.:.    ||.     .|:
  Fly   486 KQLDK-SEANAGKSKMVDQVHQQMPVE---SAKDHQQMTEEPTNSTKRKRGRKERKSPTPVLIPL 546

  Fly   343 ASKPKAKEKAAGEQKPKRSA-----------------------------------NPKTKEERNL 372
            ..|...:|....|::.::|.                                   |..|.|....
  Fly   547 GDKEIKEEPELPERRMRKSRQHVDYVVEIKDEEEDDDEVEEAEVDDDSSATISPHNSSTDESFTS 611

  Fly   373 IRRAQLRAKPPNFV-----CDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHI 432
            |:|........|.:     |:.||:.|:....::.|:..||..|.|.|.:|.:.| ...||.:..
  Fly   612 IKRESSEESQHNGIGGIHTCNFCGKTFKRFSRMQDHLRLHTGEKPYVCGQCGRAF-RLKMRLVEH 675

  Fly   433 RIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQK 497
            ::|||.|..:.|..||...|     .|.:..:|               |...:...||:|..|.|
  Fly   676 QLRHRAEKAYKCDICSMPLA-----TKQDLSLH---------------MRHHKNDRRYKCDKCNK 720

  Fly   498 HYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTH-EKRPLQCDVCLKGFYQRTRLR 561
            .:.....|..|::.||....|.|..|.|::.....|..|..|| ..:|:||::|.|.|.::..:|
  Fly   721 GFVRSSDLSIHVRIHTGEKPYSCDLCGKAFRARQNLVVHRRTHLGDKPIQCELCDKRFARKIDMR 785

  Fly   562 EHELIHTGERPYWCEVCNVNFRYKYNMKSH 591
            .|...||||:||.|:.|...:..:.|:..|
  Fly   786 VHMRRHTGEKPYNCDACQRGYSSRVNLLRH 815

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206 12/66 (18%)
zf-AD 167..240 CDD:214871 14/80 (18%)
zf-C2H2 385..407 CDD:278523 5/27 (19%)
C2H2 Zn finger 387..407 CDD:275368 5/20 (25%)
zf-H2C2_2 399..422 CDD:290200 7/23 (30%)
C2H2 Zn finger 415..436 CDD:275368 6/21 (29%)
C2H2 Zn finger 444..460 CDD:275368 5/16 (31%)
C2H2 Zn finger 492..512 CDD:275368 5/20 (25%)
C2H2 Zn finger 520..540 CDD:275368 6/20 (30%)
C2H2 Zn finger 547..567 CDD:275368 6/20 (30%)
zf-met 574..597 CDD:289631 4/19 (21%)
C2H2 Zn finger 575..591 CDD:275368 3/16 (19%)
CG7372NP_648789.3 COG5048 <594..787 CDD:227381 55/214 (26%)
C2H2 Zn finger 631..651 CDD:275368 5/20 (25%)
zf-H2C2_2 644..666 CDD:290200 7/22 (32%)
zf-H2C2_2 699..724 CDD:290200 7/40 (18%)
zf-C2H2 713..735 CDD:278523 6/22 (27%)
C2H2 Zn finger 715..735 CDD:275368 5/20 (25%)
zf-H2C2_2 727..750 CDD:290200 8/23 (35%)
C2H2 Zn finger 743..763 CDD:275368 6/20 (30%)
zf-H2C2_2 755..780 CDD:290200 10/25 (40%)
C2H2 Zn finger 771..791 CDD:275368 6/20 (30%)
zf-H2C2_2 783..808 CDD:290200 10/25 (40%)
C2H2 Zn finger 799..816 CDD:275370 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3304
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.