DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and pita

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster

Alignment Length:522 Identity:119/523 (23%)
Similarity:194/523 (37%) Gaps:126/523 (24%)


  Fly   158 EEKLEELQKCRTCYND------FTADFRAKDLFD-PANSVLLFHIEVISGVWISHKPDEPRLMCP 215
            |..|.|.:.||.|..:      |..:.|.|...: |...:.:..|||.:|      ...|..:|.
  Fly     9 EAMLTEKRVCRFCLTEQKLASIFEENPRVKTTANLPLQIMAITAIEVYAG------DGMPGHICL 67

  Fly   216 ACKSALDQAIDFREMCISTELKLSQ-----------AKPSTDEVQIEAE------------NENP 257
            .|:...:....|::||...|..|.|           .||......:.::            :|.|
  Fly    68 ECRLLFEHCYRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETP 132

  Fly   258 --------ISSDHDLISDT---ENTNVEEIEDAGGDHV-------EDEATSDDQTSQEAVDEVAE 304
                    .||...:|.|.   |:..|.....||...|       |.:..::.:.|.:.|..:.|
  Fly   133 KKLLNTMAKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSMLE 197

  Fly   305 SPAAQDPLSVALGAKIFKELLDQYTGKEKARLRKGAPIASKPKAKEKAA------GEQKP--KRS 361
            ..|::          :.||..|        ..:|.:|:  |||...|::      |...|  .|.
  Fly   198 DMASE----------LEKEFPD--------IPQKASPV--KPKVLNKSSIRILNKGPAAPVEPRL 242

  Fly   362 ANPKTK---------------------EERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHML 405
            |.||.|                     ::.:..:.|: :.....|.|..|.::|.:...|.||.|
  Fly   243 ATPKVKRDDSGNVAIVTEVLDSDLPLDDQDDPTKNAE-KVATDVFPCPDCERSFPLQQLLEIHRL 306

  Fly   406 RHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPR 470
            .|||::::||..|.|:|:..|....| ...|.||.||.|..||:.|.......:|| ..|...|:
  Fly   307 NHTRSRSFQCLLCEKSFFSKYDLAKH-NFVHTGERPFKCAICSKAFTRKALLHRHE-RTHTDVPK 369

  Fly   471 LIVKRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKR 535
            .|                   |..|:|.:.|:..:..|.:.|.....::|..|:||::....|:|
  Fly   370 FI-------------------CVYCEKPFLSRQEMEKHAERHQKKRPFQCGVCTKSFAFKQGLER 415

  Fly   536 HEMTHEKR-PLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANSKMHQD 599
            ||..|... |..|..|.:.|...::|..|.:.|.|:|.|.|:.|:.::...:::..|..:.....
  Fly   416 HETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTS 480

  Fly   600 NA 601
            :|
  Fly   481 DA 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 19/80 (24%)
zf-C2H2 385..407 CDD:278523 8/22 (36%)
C2H2 Zn finger 387..407 CDD:275368 7/20 (35%)
zf-H2C2_2 399..422 CDD:290200 11/23 (48%)
C2H2 Zn finger 415..436 CDD:275368 6/21 (29%)
C2H2 Zn finger 444..460 CDD:275368 4/16 (25%)
C2H2 Zn finger 492..512 CDD:275368 5/20 (25%)
C2H2 Zn finger 520..540 CDD:275368 8/20 (40%)
C2H2 Zn finger 547..567 CDD:275368 5/20 (25%)
zf-met 574..597 CDD:289631 3/23 (13%)
C2H2 Zn finger 575..591 CDD:275368 2/16 (13%)
pitaNP_611806.3 zf-AD 17..92 CDD:214871 19/81 (23%)
COG5048 <281..506 CDD:227381 61/224 (27%)
C2H2 Zn finger 288..308 CDD:275368 7/20 (35%)
C2H2 Zn finger 316..336 CDD:275368 6/21 (29%)
zf-H2C2_2 328..353 CDD:290200 10/26 (38%)
C2H2 Zn finger 344..364 CDD:275368 6/21 (29%)
C2H2 Zn finger 372..388 CDD:275370 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 8/20 (40%)
C2H2 Zn finger 428..448 CDD:275368 5/20 (25%)
C2H2 Zn finger 456..476 CDD:275368 3/20 (15%)
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.