DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and CG31441

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_731558.1 Gene:CG31441 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster

Alignment Length:472 Identity:107/473 (23%)
Similarity:170/473 (36%) Gaps:156/473 (33%)


  Fly   161 LEELQK-CRTCYNDFT-ADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQ 223
            :.||:. ||||..:.| ...||..||:.:|...:..:|.|:.:::......|.|:|..||..||:
  Fly     1 MSELRSICRTCGKNVTNLQGRATKLFNKSNYHFISILENITDMYLEFDTTLPHLICQCCKVQLDR 65

  Fly   224 AIDFREMCI-------STELKLSQAKPSTDEVQIEAENENPISSDHDLISDTENTNVEEIEDAGG 281
            .:.||..|:       :...||.:.|...||   |.:..:......||...|:......:.|..|
  Fly    66 ILTFRNKCLEVHKSFMAANRKLLRKKAIVDE---ELDKPDVEKLQQDLWDHTDQEMCVAMADTAG 127

  Fly   282 ----DHVEDE-------ATSDDQTSQEAV----DEVAESPAAQDPLSVALGAKIFKELLDQYTGK 331
                ||.::|       ||.:::..:|.|    :||.........:|:.                
  Fly   128 LLREDHNDNEKAKDAEDATQNEKNQEEQVQVQTEEVEHCQEQLHNMSII---------------- 176

  Fly   332 EKARLRKGAPIASKPKAKEKAAGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRM 396
                              .|....:.|||:       :||          ..::.|||||..|:.
  Fly   177 ------------------SKGVSARVPKRT-------KRN----------SKSWFCDQCGGVFKS 206

  Fly   397 SHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHE 461
            |..|::|:.||:                             |..||||..|...:......::| 
  Fly   207 STYLKLHLQRHS-----------------------------GHKPFACDICQAKYYTDNEMRRH- 241

  Fly   462 SEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKS 526
                    |::                                       ||||..|.|:.|||:
  Fly   242 --------RIL---------------------------------------HTDARPYACRFCSKT 259

  Fly   527 YSDPNKLKRHEMTH-EKRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKS 590
            |...:....||.|| .:||.||..|.|.|...:..::||::||.:|.|.||:|:..|....::..
  Fly   260 YRGCSSKVVHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTL 324

  Fly   591 HANSKMHQDNARKLGVV 607
            |.::|:||..|....:|
  Fly   325 HQSTKLHQRRAESARIV 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 24/81 (30%)
zf-C2H2 385..407 CDD:278523 10/22 (45%)
C2H2 Zn finger 387..407 CDD:275368 10/20 (50%)
zf-H2C2_2 399..422 CDD:290200 4/23 (17%)
C2H2 Zn finger 415..436 CDD:275368 0/21 (0%)
C2H2 Zn finger 444..460 CDD:275368 2/16 (13%)
C2H2 Zn finger 492..512 CDD:275368 0/20 (0%)
C2H2 Zn finger 520..540 CDD:275368 8/20 (40%)
C2H2 Zn finger 547..567 CDD:275368 6/20 (30%)
zf-met 574..597 CDD:289631 6/23 (26%)
C2H2 Zn finger 575..591 CDD:275368 4/16 (25%)
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 22/75 (29%)
COG5048 <174..337 CDD:227381 62/291 (21%)
C2H2 Zn finger 197..217 CDD:275370 10/20 (50%)
C2H2 Zn finger 225..245 CDD:275368 4/68 (6%)
C2H2 Zn finger 253..273 CDD:275368 8/20 (40%)
zf-H2C2_2 268..290 CDD:290200 11/22 (50%)
C2H2 Zn finger 281..301 CDD:275368 6/20 (30%)
C2H2 Zn finger 309..328 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C128789636
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.980

Return to query results.
Submit another query.