DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and Zfp819

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001014039.1 Gene:Zfp819 RGDID:1309564 Length:614 Species:Rattus norvegicus

Alignment Length:556 Identity:128/557 (23%)
Similarity:197/557 (35%) Gaps:160/557 (29%)


  Fly   171 YNDFTADFRAKDL--FDPANSVLLFHIEVISGVWISH-------KPDEPRLMCPACKSALDQAID 226
            :.|.|.||..::.  .|.|...|  :.||:..:: ||       :|:....|.....:.|.| :|
  Rat    29 FEDVTVDFSQEEWQHLDSAQRCL--YQEVMLEIY-SHLLAVGYPRPEAILQMKNRKDTRLGQ-VD 89

  Fly   227 F---------------REMCISTELKLSQAKPST----------------DEVQIEAENENPISS 260
            |               :::|::|......::..|                |..:.:.:|:.|.||
  Rat    90 FLHQRCGQGQSEHDSPQQICVTTAFPRDASRVITRGGSYCSIMEEPWQGGDPKKTDQQNQIPPSS 154

  Fly   261 DHDLISD----TENTNVEEIEDAGGD-----HVEDEATSD------DQTSQE--AVDEVAESPAA 308
            .....|.    |:|..  ..|.|||.     |:.......      ::|.|.  ..|...:|.|.
  Rat   155 PGAFFSQKAVITDNCG--GCEAAGGSIPLGPHLISTQKGSPRRCPCEKTLQPNLQTDSEHQSSAT 217

  Fly   309 QDPLSVALGAKIFKELLDQ------------YTGKEKAR-------------LRKGAPIASKPKA 348
            :.|..|....::..:.|..            .||.:.|.             |.:..|:......
  Rat   218 KQPNGVVDSCRLCTQGLSSAVCTTHSTGERACTGNQCANVLSPRSPLRQHGILSQDEPVEYTKDE 282

  Fly   349 KEKAAGE---------------------------QKPKRSANPKTKEERNLI------------- 373
            |...||.                           ||.:.|.:|.|..|....             
  Rat   283 KAFTAGSASCEQQTTNTLDLETHFICHICGKSFLQKSELSFHPGTSREETRYECPDCLKSLTTSP 347

  Fly   374 ------RRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHI 432
                  ..|..:.||  :.|..||::|..:.:|::|:..||..:.|.|::|.|.|....:...|.
  Rat   348 SSLQAHHEAHTKQKP--YTCHDCGKSFSYASHLKVHLRIHTGERPYVCSDCGKAFSQKSVLTTHQ 410

  Fly   433 RIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQK 497
            || |.||.|:||..|.:.|.|....:|| |..|..              .||     |:|:.|.|
  Rat   411 RI-HTGEKPYACSHCGKLFVYASDLRKH-SRFHTG--------------EKP-----YECRDCGK 454

  Fly   498 HYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHE-KRPLQCDVCLKGFYQRTRLR 561
            .:::|..|..|.:.||....|||:.|.||:...:.|:.|..||. ::|..|..|.|.|...:.|.
  Rat   455 VFSNKSHLPVHRRIHTGEKPYKCRDCGKSFRRKSHLQVHGRTHTGEKPYACPDCGKAFSHSSVLS 519

  Fly   562 EHELIHTGERPYWCEVCNVNFRYKYNMKSHANSKMH 597
            .|:.||||||||.|..|......|..:..|  .::|
  Rat   520 THQRIHTGERPYVCSDCGKAMSSKAQLSEH--QRVH 553

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 19/93 (20%)
zf-C2H2 385..407 CDD:278523 6/22 (27%)
C2H2 Zn finger 387..407 CDD:275368 6/20 (30%)
zf-H2C2_2 399..422 CDD:290200 8/23 (35%)
C2H2 Zn finger 415..436 CDD:275368 7/21 (33%)
C2H2 Zn finger 444..460 CDD:275368 5/16 (31%)
C2H2 Zn finger 492..512 CDD:275368 6/20 (30%)
C2H2 Zn finger 520..540 CDD:275368 7/20 (35%)
C2H2 Zn finger 547..567 CDD:275368 7/20 (35%)
zf-met 574..597 CDD:289631 4/23 (17%)
C2H2 Zn finger 575..591 CDD:275368 3/16 (19%)
Zfp819NP_001014039.1 KRAB 27..81 CDD:214630 13/55 (24%)
KRAB 27..66 CDD:279668 11/40 (28%)
C2H2 Zn finger 336..357 CDD:275368 1/21 (5%)
COG5048 <346..538 CDD:227381 70/215 (33%)
zf-C2H2 363..385 CDD:278523 6/22 (27%)
C2H2 Zn finger 365..385 CDD:275368 6/20 (30%)
zf-H2C2_2 377..402 CDD:290200 9/25 (36%)
C2H2 Zn finger 393..413 CDD:275368 7/21 (33%)
zf-H2C2_2 406..430 CDD:290200 11/25 (44%)
C2H2 Zn finger 421..441 CDD:275368 7/21 (33%)
zf-H2C2_2 433..458 CDD:290200 10/45 (22%)
C2H2 Zn finger 449..469 CDD:275368 6/20 (30%)
zf-H2C2_2 464..486 CDD:290200 9/22 (41%)
C2H2 Zn finger 477..497 CDD:275368 7/20 (35%)
zf-H2C2_2 489..514 CDD:290200 9/25 (36%)
C2H2 Zn finger 505..525 CDD:275368 7/20 (35%)
zf-H2C2_2 518..539 CDD:290200 12/21 (57%)
C2H2 Zn finger 533..553 CDD:275368 4/22 (18%)
zf-H2C2_2 546..568 CDD:290200 2/11 (18%)
C2H2 Zn finger 561..581 CDD:275368
zf-H2C2_2 573..598 CDD:290200
C2H2 Zn finger 589..609 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.