DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and Zfp606

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_038956593.1 Gene:Zfp606 / 292610 RGDID:1309810 Length:787 Species:Rattus norvegicus


Alignment Length:346 Identity:99/346 - (28%)
Similarity:143/346 - (41%) Gaps:66/346 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 DDQTSQEAVDEVAESPAAQDPLSVALGAKIFKELLDQYTGKEKARLRKGAPIASKPKAKEKAAGE 355
            |...:|......||.|...:....:.   |:...|.|:        :|..| ..||...:|.   
  Rat   380 DSLLAQHTSTYTAEKPYEFNKCGTSF---IWSSYLIQH--------KKTHP-GDKPYECDKC--- 429

  Fly   356 QKPKRSANPKTKEER---------------------NLIRRAQLRAKPPNFVCDQCGQAFRMSHN 399
            :|..|:.:..||.||                     :||...::......:||::||::|..:.:
  Rat   430 RKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHTRIHTGEKPYVCNECGKSFNWNSH 494

  Fly   400 LRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEV 464
            |..|...||..|.::||||.|:|..:.....|:|: |.||.||.|..|.:.|....|..|||...
  Rat   495 LIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRM-HTGEKPFKCDECEKAFRDYSALSKHERTH 558

  Fly   465 HNAAP--------------RLIV-KRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTD 514
            ..|.|              .||. :|.:....|       |.|:.|.|.:..:.||..|...|:.
  Rat   559 SGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKP-------YNCQECGKAFRERSALTKHEIIHSG 616

  Fly   515 ANAYKCQRCSKSYSDPNKLKRHEMTHE-KRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVC 578
            ...|:|.:|.||.|....|.||:.||. ::|.:|:.|.|.|.|...|..|..|||||:||.|..|
  Rat   617 IKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGKSFSQSCHLVAHRRIHTGEKPYKCNQC 681

  Fly   579 NVNFRYKYNMKSH--ANSKMH 597
            ..:|    |..||  |:.:.|
  Rat   682 ERSF----NCSSHLIAHRRTH 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871
zf-C2H2 385..407 CDD:278523 7/21 (33%)
C2H2 Zn finger 387..407 CDD:275368 6/19 (32%)
zf-H2C2_2 399..422 CDD:290200 10/22 (45%)
C2H2 Zn finger 415..436 CDD:275368 8/20 (40%)
C2H2 Zn finger 444..460 CDD:275368 4/15 (27%)
C2H2 Zn finger 492..512 CDD:275368 6/19 (32%)
C2H2 Zn finger 520..540 CDD:275368 8/19 (42%)
C2H2 Zn finger 547..567 CDD:275368 7/19 (37%)
zf-met 574..597 CDD:289631 7/24 (29%)
C2H2 Zn finger 575..591 CDD:275368 4/15 (27%)
Zfp606XP_038956593.1 KRAB 57..116 CDD:214630
COG5048 386..785 CDD:227381 97/340 (29%)
C2H2 Zn finger 399..418 CDD:275368 4/29 (14%)
C2H2 Zn finger 426..446 CDD:275368 7/22 (32%)
C2H2 Zn finger 454..474 CDD:275368 2/19 (11%)
C2H2 Zn finger 482..502 CDD:275368 6/19 (32%)
C2H2 Zn finger 510..530 CDD:275368 8/20 (40%)
C2H2 Zn finger 538..558 CDD:275368 7/19 (37%)
C2H2 Zn finger 566..586 CDD:275368 3/19 (16%)
C2H2 Zn finger 594..614 CDD:275368 6/19 (32%)
C2H2 Zn finger 622..642 CDD:275368 8/19 (42%)
C2H2 Zn finger 650..670 CDD:275368 7/19 (37%)
C2H2 Zn finger 678..698 CDD:275368 7/23 (30%)
C2H2 Zn finger 706..726 CDD:275368
C2H2 Zn finger 734..754 CDD:275368
C2H2 Zn finger 762..782 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24376
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.