| Sequence 1: | NP_650051.1 | Gene: | CG6689 / 41345 | FlyBaseID: | FBgn0037877 | Length: | 613 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011240753.1 | Gene: | Zfp26 / 22688 | MGIID: | 99173 | Length: | 965 | Species: | Mus musculus | 
| Alignment Length: | 609 | Identity: | 143/609 - (23%) | 
|---|---|---|---|
| Similarity: | 239/609 - (39%) | Gaps: | 124/609 - (20%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    45 CGYTEESLKLKNPCICIEH-------FKDEDIEGSLKFEMGLAKKRTLRPGAVPCVNKSQESGSD 102 
  Fly   103 RARKERSQRRRNQELVAE---LLAEEEAKLIHPEATSFEQDSVYLSETVTMELDP----LSGEEK 160 
  Fly   161 LEELQKCRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPD----------EPRLMCP 215 
  Fly   216 ACKSALDQAIDFREMCISTEL--KLSQAKPSTDEVQIEAE-NENPISSDHDLISDTENTNVEEIE 277 
  Fly   278 DAGGDHVEDEATSDDQTSQ--EAVDEVAESP-------AAQDPLSVALGAKIFKELLDQYTGKEK 333 
  Fly   334 ARLRKGAPIASKPKAKEKAAGEQKPKRSANPKT----------------KEER--------NLIR 374 
  Fly   375 RAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGE 439 
  Fly   440 TPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYA-SKY 503 
  Fly   504 ALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHE-KRPLQCDVCLKGFYQRTRLREHELIH 567 
  Fly   568 TGERPYWCEVCNVNFRYKYNMKSH 591 | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24376 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||