DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and Zfp691

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001139407.1 Gene:Zfp691 MGIID:3041163 Length:283 Species:Mus musculus

Alignment Length:276 Identity:76/277 (27%)
Similarity:122/277 (44%) Gaps:38/277 (14%)


  Fly   330 GKEK--ARLRKGAPIASKPKAKEKAAGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQ 392
            |:|.  |.|....|..::.|...:|.|.:.|...::|:|.|:.              |:|.|||:
Mouse    40 GQESLLAGLHGTHPPKTRQKVTAQAGGPRDPMLFSSPETDEKL--------------FICAQCGK 90

  Fly   393 AFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGAR 457
            .|..:.|||.|...||..|.|:|:||.|:|..:..|..|.|| |..|..:.|..|.|:|     |
Mouse    91 TFNNTSNLRTHQRIHTGEKPYKCSECGKSFSRSSNRIRHERI-HLEEKHYQCAKCQESF-----R 149

  Fly   458 QKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQR 522
            ::.:...|..      ..:..:|         |:|.:|.|.:.....|..|.::|.:...|.|..
Mouse   150 RRSDLTTHQQ------DHLGQRP---------YRCDICGKSFTQSSTLAVHHRTHLEPAPYICCE 199

  Fly   523 CSKSYSDPNKLKRHEMTHE-KRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKY 586
            |.||:|:.:....|..||. :||.:|..|.:.|...:....|:..|.||:||.|.:|..:|....
Mouse   200 CGKSFSNSSSFGVHHRTHTGERPYECTECGRTFSDISNFGAHQRTHRGEKPYRCTLCGKHFSRSS 264

  Fly   587 NMKSHANSKMHQDNAR 602
            |:..|..:.:.:.:.:
Mouse   265 NLIRHQKTHLGEQDEK 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871
zf-C2H2 385..407 CDD:278523 10/22 (45%)
C2H2 Zn finger 387..407 CDD:275368 9/20 (45%)
zf-H2C2_2 399..422 CDD:290200 12/23 (52%)
C2H2 Zn finger 415..436 CDD:275368 9/21 (43%)
C2H2 Zn finger 444..460 CDD:275368 5/16 (31%)
C2H2 Zn finger 492..512 CDD:275368 5/20 (25%)
C2H2 Zn finger 520..540 CDD:275368 7/20 (35%)
C2H2 Zn finger 547..567 CDD:275368 4/20 (20%)
zf-met 574..597 CDD:289631 5/23 (22%)
C2H2 Zn finger 575..591 CDD:275368 4/16 (25%)
Zfp691NP_001139407.1 COG5048 <70..234 CDD:227381 57/199 (29%)
C2H2 Zn finger 85..105 CDD:275368 9/20 (45%)
zf-H2C2_2 97..122 CDD:290200 13/25 (52%)
C2H2 Zn finger 113..133 CDD:275368 9/21 (43%)
C2H2 Zn finger 141..161 CDD:275368 6/31 (19%)
zf-H2C2_2 153..178 CDD:290200 6/40 (15%)
C2H2 Zn finger 169..189 CDD:275368 5/20 (25%)
C2H2 Zn finger 197..217 CDD:275368 7/20 (35%)
zf-H2C2_2 212..233 CDD:290200 8/21 (38%)
C2H2 Zn finger 225..245 CDD:275368 4/20 (20%)
zf-C2H2 251..273 CDD:278523 6/22 (27%)
C2H2 Zn finger 253..273 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3304
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.