DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and M03D4.4

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans

Alignment Length:194 Identity:50/195 (26%)
Similarity:80/195 (41%) Gaps:38/195 (19%)


  Fly   442 FACGFCSETFAYPGARQKHESEVHNA-----------------------------------APRL 471
            :.|..||..|......|:||.|.|..                                   :.:|
 Worm     5 YLCRDCSGAFHSLDELQRHEREEHETVEQGDQEEDRMEDDSDELAMIKIKIEDSDFLSDTDSSQL 69

  Fly   472 IVKRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRH 536
            .:....|.......|..||:|:.|.:.:|.|..|..|::.|:....:.|.:|.|.:.....||:|
 Worm    70 SMNPTTPSEKSSSGEKGRYECEDCHEMFAVKRELATHMRIHSGEQPHSCTQCGKEFGTRQLLKKH 134

  Fly   537 EMTHE-KRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANSKMHQD 599
            .|.|. :|...|..|.|.|:|:..|.:|.:||:|.||:.|..|:..|.:|:::..|  .|:||:
 Worm   135 WMWHTGERSHVCPHCNKAFFQKGHLTQHLMIHSGGRPHECPQCHKTFIFKFDLNRH--MKIHQE 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871
zf-C2H2 385..407 CDD:278523
C2H2 Zn finger 387..407 CDD:275368
zf-H2C2_2 399..422 CDD:290200
C2H2 Zn finger 415..436 CDD:275368
C2H2 Zn finger 444..460 CDD:275368 5/16 (31%)
C2H2 Zn finger 492..512 CDD:275368 6/20 (30%)
C2H2 Zn finger 520..540 CDD:275368 7/20 (35%)
C2H2 Zn finger 547..567 CDD:275368 8/20 (40%)
zf-met 574..597 CDD:289631 6/23 (26%)
C2H2 Zn finger 575..591 CDD:275368 4/16 (25%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 6/20 (30%)
zf-H2C2_2 102..127 CDD:290200 6/25 (24%)
C2H2 Zn finger 118..138 CDD:275368 7/20 (35%)
C2H2 Zn finger 146..166 CDD:275368 8/20 (40%)
zf-H2C2_2 158..181 CDD:290200 9/23 (39%)
zf-C2H2 172..194 CDD:278523 6/24 (25%)
C2H2 Zn finger 174..194 CDD:275368 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.