DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and eor-1

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_500645.1 Gene:eor-1 WormBaseID:WBGene00001324 Length:909 Species:Caenorhabditis elegans

Alignment Length:676 Identity:136/677 (20%)
Similarity:218/677 (32%) Gaps:194/677 (29%)


  Fly    38 FKAWLAFCGYTEESLKL--KNPCICIEHFKDEDIEGSLKFEMGLAKKRTLRPGAVPCVNKSQESG 100
            |.|...:|..|:|.|.:  |:|.:               ||:.|               ....||
 Worm    67 FDAIFKYCKITKEQLTINSKSPQV---------------FELFL---------------NYMYSG 101

  Fly   101 S---DRARKERSQRRRNQELVAELLAEEEAKLIHPEATSFEQDSVYLSETVTMELDPLSGEEKLE 162
            :   ||:......|..|..|:.:|.....|.|           ..||.....:.:..|:....|.
 Worm   102 TVIIDRSSVSELLRFANNFLIVKLKVYCAAYL-----------DRYLDAANCLSIRTLAQRYNLP 155

  Fly   163 ELQKCRTCYNDFTAD---FRAKDLF------------DPANSVLLFHIEVIS------------G 200
            .|.|..|.|.|...:   ..::|:.            ||.      :::.|:            |
 Worm   156 GLVKSATDYFDSNLNRCLLESRDIIGYTYTQLTRLIGDPK------YVDCITSDTYLKLIVRWVG 214

  Fly   201 VWISHKPDEPRLMCPACKSALDQAIDFREMCISTELKLSQAKPSTDEVQ---------IEAEN-- 254
            ..:|.:.:..||:..:|        :|||:...|...|....|...:.|         :|..|  
 Worm   215 EEVSKREEIFRLLLESC--------EFREVSADTLEFLLDYSPLLSKSQKSRFLLLHVMETNNML 271

  Fly   255 ----ENPISS------DHDLISDTENTNVEEIEDAGGDHVEDEATSDDQTSQEAVDEVAESPAAQ 309
                ...:||      |..::.|......:..:.:..:...|:..:|...:...|.|.......:
 Worm   272 MEKYSTQLSSLRQKIVDLPILHDPSQFEDDIYDSSDSEEDPDDYIADGHPTSAQVVEYGNDVNNR 336

  Fly   310 DPLSVALGAKIFKELLDQYTGKEKARLRKGAPI-----ASKP----------------------- 346
            ..:.:|......|:.|.:..|.:|..|....||     .|.|                       
 Worm   337 LKMKIAFQPGNEKKRLKRPKGMKKHHLHPIPPINATENESIPWIDEDEIDGVYATCSLEGCHTYG 401

  Fly   347 ----------KAKEKAAGEQKPK-------RSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAF 394
                      :.:|....|..|.       |:||.:..|:    .:|:...:...::|..|....
 Worm   402 PVDNLDPDDCEDEEDQPDENGPSTCIFCGLRTANEELLEK----HKARHHNRNTYYMCHLCEFET 462

  Fly   395 RMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFC-------SETFA 452
            ..|....:|...|.....|:|..||.|..:......| |::|..|..|.||.|       |:.||
 Worm   463 NWSKQFYLHCAEHWTEIPYRCETCPFTSNEIQEFLTH-RLQHTDERFFKCGECAWKGRTRSQLFA 526

  Fly   453 YP------GARQKHESEV------HNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKYA- 504
            :.      ..|..|..|.      |:.....:....:|:|         |.|:.|  .:|:|.| 
 Worm   527 HERMHSVLDDRSLHCEECGRGFQQHSTLDHHVASHNDPRP---------YICEDC--GFATKTAD 580

  Fly   505 -LGWHIKSHTDANAYKCQRCSKSYSDPNK--LKRHEMTH-EKRPLQCDVCLKGFYQRTRLREHEL 565
             |..|.:.||..| :.|......||...|  |..|..|| ..|...|.:|.:||.:::.|..||.
 Worm   581 HLSLHRRQHTGDN-FSCHIAGCDYSSTKKSQLAAHLRTHMAVRAHLCKICGRGFIEKSHLVRHER 644

  Fly   566 IHTGERPYWCEVCNVNFRYKYNMKSH 591
            ||..|:|:.|:.|......:..:|.|
 Worm   645 IHLEEKPFKCDQCEYASSRRDKLKEH 670

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206 11/60 (18%)
zf-AD 167..240 CDD:214871 17/100 (17%)
zf-C2H2 385..407 CDD:278523 4/22 (18%)
C2H2 Zn finger 387..407 CDD:275368 4/20 (20%)
zf-H2C2_2 399..422 CDD:290200 7/23 (30%)
C2H2 Zn finger 415..436 CDD:275368 6/21 (29%)
C2H2 Zn finger 444..460 CDD:275368 7/29 (24%)
C2H2 Zn finger 492..512 CDD:275368 7/22 (32%)
C2H2 Zn finger 520..540 CDD:275368 7/22 (32%)
C2H2 Zn finger 547..567 CDD:275368 8/20 (40%)
zf-met 574..597 CDD:289631 4/19 (21%)
C2H2 Zn finger 575..591 CDD:275368 3/16 (19%)
eor-1NP_500645.1 BTB 32..134 CDD:279045 21/108 (19%)
BTB 43..137 CDD:197585 22/111 (20%)
BACK 142..242 CDD:197943 20/114 (18%)
C2H2 Zn finger 455..475 CDD:275368 4/20 (20%)
zf-C2H2_8 <481..527 CDD:292531 16/47 (34%)
C2H2 Zn finger 483..503 CDD:275368 6/21 (29%)
C2H2 Zn finger 511..531 CDD:275368 6/20 (30%)
C2H2 Zn finger 541..561 CDD:275368 2/20 (10%)
C2H2 Zn finger 569..589 CDD:275368 7/22 (32%)
C2H2 Zn finger 601..618 CDD:275368 6/17 (35%)
C2H2 Zn finger 626..646 CDD:275368 8/20 (40%)
zf-H2C2_2 638..663 CDD:290200 9/25 (36%)
C2H2 Zn finger 654..674 CDD:275368 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.