DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and ZNF560

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_689689.2 Gene:ZNF560 HGNCID:26484 Length:790 Species:Homo sapiens

Alignment Length:267 Identity:80/268 (30%)
Similarity:103/268 (38%) Gaps:54/268 (20%)


  Fly   376 AQLRA----KPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRH 436
            |.||.    ||  |.|.:||:.|..|..|||||..||..:.|||.:|.|.|........|:| .|
Human   505 AHLRTHTGEKP--FKCYKCGKPFTSSACLRIHMRTHTEERLYQCKKCGKAFTKCSYLTKHLR-TH 566

  Fly   437 RGETPFACGFCSETFAYPGARQKHESEVHNAAP-------------RLIVKRINPKPMPKPRESV 488
            .||.|:.|..|.:.|.......||........|             ..:.|.:......||    
Human   567 AGEKPYECMKCGKAFTERSYLTKHLRRHSGEKPYECKKCGKAFTERSDLTKHLRRHTGDKP---- 627

  Fly   489 RYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTH--EK--------- 542
             |:.|.|.|.:....:|..|:::||....|||..|.|:||....|.:|..||  ||         
Human   628 -YEYKDCGKAFVVSSSLVDHLRTHTGYKPYKCNACEKAYSRSCVLTQHLKTHAAEKTSECNACGN 691

  Fly   543 ------------------RPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMK 589
                              :|.:|..|.|.|...:.|..|..|||||:||.|:.|...||......
Human   692 SFRNSMCFHDRLKTLTKIKPYKCKDCGKAFTCHSDLTNHVRIHTGEKPYKCKECGKAFRTSSGRI 756

  Fly   590 SHANSKM 596
            .|..:.|
Human   757 QHLRTHM 763

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871
zf-C2H2 385..407 CDD:278523 11/22 (50%)
C2H2 Zn finger 387..407 CDD:275368 10/20 (50%)
zf-H2C2_2 399..422 CDD:290200 12/23 (52%)
C2H2 Zn finger 415..436 CDD:275368 6/21 (29%)
C2H2 Zn finger 444..460 CDD:275368 4/16 (25%)
C2H2 Zn finger 492..512 CDD:275368 5/20 (25%)
C2H2 Zn finger 520..540 CDD:275368 8/20 (40%)
C2H2 Zn finger 547..567 CDD:275368 7/20 (35%)
zf-met 574..597 CDD:289631 6/24 (25%)
C2H2 Zn finger 575..591 CDD:275368 4/16 (25%)
ZNF560NP_689689.2 KRAB 13..69 CDD:214630
KRAB 13..50 CDD:279668
KRAB 110..161 CDD:214630
KRAB 110..149 CDD:279668
C2H2 Zn finger 294..314 CDD:275368
C2H2 Zn finger 323..342 CDD:275368
COG5048 344..754 CDD:227381 78/257 (30%)
C2H2 Zn finger 350..370 CDD:275368
zf-H2C2_2 362..386 CDD:290200
C2H2 Zn finger 378..398 CDD:275368
C2H2 Zn finger 406..426 CDD:275368
C2H2 Zn finger 434..454 CDD:275368
C2H2 Zn finger 490..510 CDD:275368 3/5 (60%)
zf-H2C2_2 502..527 CDD:290200 10/24 (42%)
C2H2 Zn finger 518..538 CDD:275368 10/20 (50%)
zf-H2C2_2 531..554 CDD:290200 13/23 (57%)
C2H2 Zn finger 546..566 CDD:275368 6/21 (29%)
zf-H2C2_2 558..582 CDD:290200 9/25 (36%)
C2H2 Zn finger 574..594 CDD:275368 5/20 (25%)
zf-H2C2_2 586..610 CDD:290200 3/24 (13%)
zf-C2H2 600..622 CDD:278523 1/22 (5%)
C2H2 Zn finger 602..622 CDD:275368 1/20 (5%)
C2H2 Zn finger 630..650 CDD:275368 5/20 (25%)
C2H2 Zn finger 658..678 CDD:275368 8/20 (40%)
C2H2 Zn finger 714..734 CDD:275368 7/20 (35%)
zf-H2C2_2 726..751 CDD:290200 13/25 (52%)
C2H2 Zn finger 742..762 CDD:275368 5/20 (25%)
zf-H2C2_2 757..779 CDD:290200 2/8 (25%)
C2H2 Zn finger 770..790 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.