DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and znf408

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001315204.1 Gene:znf408 ZFINID:ZDB-GENE-130530-589 Length:764 Species:Danio rerio

Alignment Length:634 Identity:139/635 (22%)
Similarity:219/635 (34%) Gaps:206/635 (32%)


  Fly    76 EMGL------AKKRTL----RPGAVPCVNKSQESGSDRARKERSQRRRNQELVAELLAEEEAKLI 130
            ::||      .||.||    .||..  ::|.:|.|...|.:...:|..:.|:.....|       
Zfish    40 QLGLWCVGRVLKKDTLLGLEEPGET--ISKEKEEGLQNASQSVYKREISDEVCWMQFA------- 95

  Fly   131 HPEATSFEQDSVYLSETVTMELDPLSGEEKLEELQKCRTCYNDFTADFRAKDLFDPANSVLLFHI 195
             ..|.|.|:.:|.:     :::|...|      |:.||.              ..|...:||   
Zfish    96 -CSAQSAEESNVSV-----LKVDGRLG------LKVCRD--------------IQPGTELLL--- 131

  Fly   196 EVISGVWISHKPDEPRLMCPACKSALDQAIDFREMCISTELKLSQAKPSTDEVQIEAENENPISS 260
                  |.||                .:|:        ||.:..|.:...:..|.||...|  :|
Zfish   132 ------WESH----------------PEAV--------TEEETPQVETCENREQDEALEAN--TS 164

  Fly   261 DH-----------------------DLISDTENTNVEEIEDAGGDHVEDEATSDDQTSQEAVDEV 302
            ||                       .|:.|....|...:|..|.:..|.| .||:..:.|.::.:
Zfish   165 DHFSGSPYLLQRVTQQDTKSPVTVKGLVQDNTICNSNVLEQNGMEESEAE-HSDELPATEEIESI 228

  Fly   303 AESPAAQDPLSVALGAKIFKELLDQYTGKEKARLRKGAPIASKPKAKEKAA--------GEQKPK 359
            ..|.:.....|..|              ..:..||..:.:||||:....:|        .:.||.
Zfish   229 NVSASQAQTSSQCL--------------TPERSLRTSSRLASKPRKVHSSAKRIYKRHDPKNKPD 279

  Fly   360 RSANPK-------------TKEERNLIRRAQ----LRAKPPNFVCDQCGQAFRMSHNLRIHMLRH 407
            .|:..|             .|||.:..:..|    ...:...:.|::|.::|....:|:.|...|
Zfish   280 LSSKKKLLNSKDDLMQPLTVKEESSTKQNGQDFPPFNIRERKYKCEECDKSFFQLCHLKKHKYTH 344

  Fly   408 TRTKNYQCTECPKTF-----YDAYMRNMH-----------------------IRIRHRGETPFAC 444
            ...|.|.||||.|::     :.|::. ||                       .::.|.||.||.|
Zfish   345 QNQKPYTCTECGKSYSSHESFQAHLL-MHRGQRPFKCEQCDKSYGLKRDLKEHQVLHSGEKPFVC 408

  Fly   445 GFCSETFAYPGARQKHESEVHNAA----PRLIVK------------------RINPKPMPKPRES 487
            ..|.:.||...:.:.|. |:|...    ..|.||                  |::....|     
Zfish   409 DICGKAFARRPSLRVHR-EIHRTKEPDYQALKVKCPECDKELANSGSLRNHMRLHTGERP----- 467

  Fly   488 VRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHEKRPLQCDVCLK 552
              :.|..|.|.:..:..|..|::.||....|:|..|...:|...:|:||.::|......|.||.|
Zfish   468 --HICPHCNKCFRQRGNLQGHMRIHTGEKPYRCDHCDLRFSQVPELRRHLISHTGEVYLCPVCGK 530

  Fly   553 GFYQRTRLREHELIHTGERPYWCEVCNVNF----RYKYNMKSHANSKMH 597
            .......||.||.:|||:|||.||.|...:    :.:.::|||...|.|
Zfish   531 ALRDPHTLRAHERLHTGDRPYKCEQCGKGYTMATKLRRHLKSHLEEKQH 579

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206 9/30 (30%)
zf-AD 167..240 CDD:214871 11/73 (15%)
zf-C2H2 385..407 CDD:278523 5/22 (23%)
C2H2 Zn finger 387..407 CDD:275368 5/20 (25%)
zf-H2C2_2 399..422 CDD:290200 10/23 (43%)
C2H2 Zn finger 415..436 CDD:275368 8/49 (16%)
C2H2 Zn finger 444..460 CDD:275368 4/16 (25%)
C2H2 Zn finger 492..512 CDD:275368 5/20 (25%)
C2H2 Zn finger 520..540 CDD:275368 6/20 (30%)
C2H2 Zn finger 547..567 CDD:275368 8/20 (40%)
zf-met 574..597 CDD:289631 7/27 (26%)
C2H2 Zn finger 575..591 CDD:275368 5/20 (25%)
znf408NP_001315204.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.