DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and si:ch73-382f3.1

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001243612.1 Gene:si:ch73-382f3.1 / 100151273 ZFINID:ZDB-GENE-030131-9513 Length:283 Species:Danio rerio


Alignment Length:322 Identity:66/322 - (20%)
Similarity:101/322 - (31%) Gaps:105/322 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAVPNCRNFSDCRSKRNAAQQQRLGFFRFPKCPDTFKAWLAFCGYTEESLKLKNPC--ICIEHFK 65
            |:.|||.|.:....:          .|||||.|...:.||..|    ....:..||  :|.:||:
Zfish     4 CSAPNCSNSTTIGKQ----------LFRFPKDPVRMRKWLVNC----RRDFVPTPCSRLCQDHFE 54

  Fly    66 DEDIEGSLKFEMGLAKKRTLRPGAVPC-----------------------VNK------------ 95
            :...|...:...|   .|.|:|.|:|.                       |.|            
Zfish    55 ESQFEEIARSPAG---GRKLKPNAIPTLFNVPDPPSPVTPQAVLPVKNEPVEKELNMGDHGYARR 116

  Fly    96 -----SQESGSDRARKERSQRRRNQELVAELLAEEEAKLIHPEATSFEQDSVYLSETVTMELDPL 155
                 |:|.|..||.:||                 ...|.....|..||..   ..||.::.:..
Zfish   117 QPPVDSEEDGVQRAEEER-----------------PCSLCQHYKTKLEQQQ---QHTVRLQREAE 161

  Fly   156 SGEEKLEELQKCRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKP--DEPRLMCPACK 218
            ..:::|.:|.|.......|        ||:.....|.........|| ||..  ...::.|....
Zfish   162 EMKKRLYKLSKIEKGLQVF--------LFEDQIRALTLAKRSRRAVW-SHDTLLTARKIRCAVGV 217

  Fly   219 SALDQAID-------FREMCISTELKLSQAKPSTDEVQ-----IEAENENP---ISSDHDLI 265
            ...:...:       :|.:|...|.|:..:....||:.     |.|..::|   ::||..||
Zfish   218 KGYEYLRELGYPLPSYRTLCNRLEPKMMVSTSMQDELAELGLGIIAACDSPEGNMTSDEGLI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206 28/134 (21%)
zf-AD 167..240 CDD:214871 13/81 (16%)
zf-C2H2 385..407 CDD:278523
C2H2 Zn finger 387..407 CDD:275368
zf-H2C2_2 399..422 CDD:290200
C2H2 Zn finger 415..436 CDD:275368
C2H2 Zn finger 444..460 CDD:275368
C2H2 Zn finger 492..512 CDD:275368
C2H2 Zn finger 520..540 CDD:275368
C2H2 Zn finger 547..567 CDD:275368
zf-met 574..597 CDD:289631
C2H2 Zn finger 575..591 CDD:275368
si:ch73-382f3.1NP_001243612.1 THAP 4..81 CDD:283206 26/93 (28%)
Tnp_P_element 146..>259 CDD:288840 22/124 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11471
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.