| Sequence 1: | NP_650051.1 | Gene: | CG6689 / 41345 | FlyBaseID: | FBgn0037877 | Length: | 613 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001243612.1 | Gene: | si:ch73-382f3.1 / 100151273 | ZFINID: | ZDB-GENE-030131-9513 | Length: | 283 | Species: | Danio rerio |
| Alignment Length: | 322 | Identity: | 66/322 - (20%) |
|---|---|---|---|
| Similarity: | 101/322 - (31%) | Gaps: | 105/322 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3 CAVPNCRNFSDCRSKRNAAQQQRLGFFRFPKCPDTFKAWLAFCGYTEESLKLKNPC--ICIEHFK 65
Fly 66 DEDIEGSLKFEMGLAKKRTLRPGAVPC-----------------------VNK------------ 95
Fly 96 -----SQESGSDRARKERSQRRRNQELVAELLAEEEAKLIHPEATSFEQDSVYLSETVTMELDPL 155
Fly 156 SGEEKLEELQKCRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKP--DEPRLMCPACK 218
Fly 219 SALDQAID-------FREMCISTELKLSQAKPSTDEVQ-----IEAENENP---ISSDHDLI 265 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6689 | NP_650051.1 | THAP | 2..96 | CDD:283206 | 28/134 (21%) |
| zf-AD | 167..240 | CDD:214871 | 13/81 (16%) | ||
| zf-C2H2 | 385..407 | CDD:278523 | |||
| C2H2 Zn finger | 387..407 | CDD:275368 | |||
| zf-H2C2_2 | 399..422 | CDD:290200 | |||
| C2H2 Zn finger | 415..436 | CDD:275368 | |||
| C2H2 Zn finger | 444..460 | CDD:275368 | |||
| C2H2 Zn finger | 492..512 | CDD:275368 | |||
| C2H2 Zn finger | 520..540 | CDD:275368 | |||
| C2H2 Zn finger | 547..567 | CDD:275368 | |||
| zf-met | 574..597 | CDD:289631 | |||
| C2H2 Zn finger | 575..591 | CDD:275368 | |||
| si:ch73-382f3.1 | NP_001243612.1 | THAP | 4..81 | CDD:283206 | 26/93 (28%) |
| Tnp_P_element | 146..>259 | CDD:288840 | 22/124 (18%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 52 | 1.000 | Domainoid score | I11471 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||