DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6689 and si:ch211-241b2.4

Sequence 1:NP_650051.1 Gene:CG6689 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_001922865.4 Gene:si:ch211-241b2.4 ZFINID:ZDB-GENE-081104-191 Length:294 Species:Danio rerio

Alignment Length:342 Identity:87/343 (25%)
Similarity:145/343 (42%) Gaps:71/343 (21%)


  Fly   265 ISDTENTNVEEIEDAGGDHVEDEATSDDQTSQEAVDEVAESPAAQDPLSVALGAKIFKELLD--- 326
            :.:|::.|:.::|:           .||.:..::..::.|.  .||.|::.       |:.|   
Zfish     3 MKETKDNNMNKLEE-----------EDDMSDLDSYGKIKEE--QQDLLTII-------EVEDTPH 47

  Fly   327 QY-TG--KEKARLRKGAPIASKPKAKEKAAGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCD 388
            |: ||  ..:..||...|.....|:....:                 ||.|..:..:....|.|.
Zfish    48 QFITGDTSSQTHLRDEFPCTHCGKSFSCTS-----------------NLNRHKKTHSGERPFTCV 95

  Fly   389 QCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKT--FYDAYMRNMHIRIRHRGETPFACGFCSETF 451
            |||::|....|...|...|...|::.|.:|.|:  |.||..::|..   |.|:.|:.|..|.:||
Zfish    96 QCGKSFARRENFYRHNQSHIGEKSFACMQCGKSFVFVDALKKHMRC---HSGDRPYECEQCGKTF 157

  Fly   452 AYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDAN 516
            ....:.::|           ::...:.||         |.|..|::.::....|..|.|:||||.
Zfish   158 TLMSSLKRH-----------MIIHTDLKP---------YACSQCERSFSRLDCLKKHQKTHTDAR 202

  Fly   517 AYKCQRCSKSYSDPNKLKRHEMTHE-KRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNV 580
            .:.|.:|..::|..:.||||...|. ::|..|..|.|.|.|...|.:||.:|||.:||.|.:|..
Zfish   203 PHLCLQCGSAFSSADILKRHHRIHTGEKPYSCSECGKSFTQSGHLMQHERVHTGRKPYICSICGR 267

  Fly   581 NFRYKYNMKSHANSKMH 597
            :|....|:.:|.  |.|
Zfish   268 SFSTARNLPAHI--KKH 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871
zf-C2H2 385..407 CDD:278523 8/22 (36%)
C2H2 Zn finger 387..407 CDD:275368 7/20 (35%)
zf-H2C2_2 399..422 CDD:290200 7/25 (28%)
C2H2 Zn finger 415..436 CDD:275368 7/23 (30%)
C2H2 Zn finger 444..460 CDD:275368 4/16 (25%)
C2H2 Zn finger 492..512 CDD:275368 5/20 (25%)
C2H2 Zn finger 520..540 CDD:275368 7/20 (35%)
C2H2 Zn finger 547..567 CDD:275368 8/20 (40%)
zf-met 574..597 CDD:289631 6/23 (26%)
C2H2 Zn finger 575..591 CDD:275368 4/16 (25%)
si:ch211-241b2.4XP_001922865.4 COG5048 <43..272 CDD:227381 73/269 (27%)
C2H2 Zn finger 66..86 CDD:275368 4/37 (11%)
zf-H2C2_2 78..103 CDD:290200 9/25 (36%)
C2H2 Zn finger 94..114 CDD:275368 7/20 (35%)
C2H2 Zn finger 122..142 CDD:275368 7/23 (30%)
zf-H2C2_2 134..158 CDD:290200 9/27 (33%)
C2H2 Zn finger 150..170 CDD:275368 5/31 (16%)
zf-H2C2_2 162..187 CDD:290200 6/45 (13%)
C2H2 Zn finger 178..198 CDD:275368 5/20 (25%)
C2H2 Zn finger 206..226 CDD:275368 7/20 (35%)
zf-H2C2_2 219..243 CDD:290200 10/24 (42%)
C2H2 Zn finger 234..254 CDD:275368 8/20 (40%)
zf-H2C2_2 246..271 CDD:290200 11/25 (44%)
C2H2 Zn finger 262..282 CDD:275368 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.