DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sodh-2 and YNL134C

Sequence 1:NP_524311.1 Gene:Sodh-2 FlyBaseID:FBgn0022359 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_014265.3 Gene:YNL134C SGDID:S000005078 Length:376 Species:Saccharomyces cerevisiae

Alignment Length:257 Identity:58/258 (22%)
Similarity:105/258 (41%) Gaps:64/258 (25%)


  Fly    22 PIPEIADDEVLLAMDSVGICGSDVHYLAHGRIGDFVL-TKPMIIGHEAAGVVAKLGKKVTTLK-- 83
            ||||:.:..||:  .:|.:.|:...:    :..||.: .:..::|.:|||.:.|||..|...:  
Yeast    26 PIPELEEGFVLI--KTVAVAGNPTDW----KHIDFKIGPQGALLGCDAAGQIVKLGPNVDAARFA 84

  Fly    84 VGDRV-AIEPGVPCRYCDHCKQGRYNLCADMVFCATPPYDGNLTRY--------YKHAADFCF-- 137
            :||.: .:..|...|:                     |.:|....|        ||.|.:|..  
Yeast    85 IGDYIYGVIHGASVRF---------------------PSNGAFAEYSAISSETAYKPAREFRLCG 128

  Fly   138 --KLPD-HVSMEEGALLEPLSV---GVHACRRAGVGLGSK---------VLIL-GAGPIG-LVTL 185
              |||: .|...|||:..|:|:   |:......|:.:..|         :|.. ||..:| ::..
Yeast   129 KDKLPEGPVKSLEGAVSLPVSLTTAGMILTHSFGLDMTWKPSKAQRDQPILFWGGATAVGQMLIQ 193

  Fly   186 LAAQAMGASEILITDLVQQRLDVAKELGATHTLLLQRDQSAEETVKVVHQTMSEVPDKSIDC 247
            ||.:..|.|:|::. ..::...:.||.||....    |....:.::.:.:..:.:| ..:||
Yeast   194 LAKKLNGFSKIIVV-ASRKHEKLLKEYGADELF----DYHDADVIEQIKKKYNNIP-YLVDC 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sodh-2NP_524311.1 PLN02702 4..346 CDD:215378 58/258 (22%)
sorbitol_DH 8..349 CDD:176188 58/258 (22%)
YNL134CNP_014265.3 enoyl_reductase_like 9..375 CDD:176211 58/258 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116820712
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.