DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sodh-2 and XYL2

Sequence 1:NP_524311.1 Gene:Sodh-2 FlyBaseID:FBgn0022359 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_013171.1 Gene:XYL2 SGDID:S000004060 Length:356 Species:Saccharomyces cerevisiae

Alignment Length:329 Identity:145/330 (44%)
Similarity:217/330 (66%) Gaps:5/330 (2%)


  Fly    23 IPEIAD-DEVLLAMDSVGICGSDVHYLAHGRIGDFVLTKPMIIGHEAAGVVAKLGKKVTTLKVGD 86
            ||:|:| :||::.:.:.||||||:||..||||.::|:..||::|||::|:||.:|:.|.||||||
Yeast    25 IPKISDPNEVIIQIKATGICGSDIHYYTHGRIANYVVESPMVLGHESSGIVALIGENVKTLKVGD 89

  Fly    87 RVAIEPGVPCRYCDHCKQGRYNLCADMVFCATPPYDGNLTRYYKHAADFCFKLPDHVSMEEGALL 151
            |||:|||:|.|:....|:|||||..::.|.||||:||.||:|||...||.:||||.||.|||||:
Yeast    90 RVALEPGIPDRFSPEMKEGRYNLDPNLKFAATPPFDGTLTKYYKTMKDFVYKLPDDVSFEEGALI 154

  Fly   152 EPLSVGVHACRRAGVGLGSKVLILGAGPIGLVTLLAAQAMGASEILITDLVQQRLDVAKELGATH 216
            |||||.:||.:.|.:..|::.::.|||||||:....|...||::::..||::.:|:.|::.||||
Yeast   155 EPLSVAIHANKLAKIKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATH 219

  Fly   217 TLLLQRDQSAEETV-KVVHQTMSEV-PDKSIDCCGAESSARLAIFATRSGGVVVVVGMGAPEVKL 279
             ::...|.....|| .|:.:.:.:. .|...:|.|||...|..|...::||.:|.||||..|::.
Yeast   220 -IVNSGDLPHGVTVDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAGGTIVQVGMGQEEIQF 283

  Fly   280 PLINALAREIDIRGVFRYC-NDYSAALALVASGKVNVKRLVTHHYDITETAEAFETSRRGTGGAI 343
            |:.....:|:..:|.|||| .|||.::.||:|.|:::|..:||.|...:..||||.:.......|
Yeast   284 PISIIPTKELTFQGCFRYCQGDYSDSIELVSSRKLSLKPFITHRYSFKDAVEAFEETSHHPLNNI 348

  Fly   344 KVMI 347
            |.:|
Yeast   349 KTII 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sodh-2NP_524311.1 PLN02702 4..346 CDD:215378 144/327 (44%)
sorbitol_DH 8..349 CDD:176188 145/330 (44%)
XYL2NP_013171.1 sorbitol_DH 9..354 CDD:176188 145/330 (44%)
Tdh 9..353 CDD:223991 145/330 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1063
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 305 1.000 Inparanoid score I483
Isobase 1 0.950 0 Normalized mean entropy S593
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002115
OrthoInspector 1 1.000 T133806
orthoMCL 1 0.900 OOG5_126928
Panther 1 1.100 O PTHR43161
Phylome 1 0.910 0.897 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R311
TreeFam 1 0.960
1211.810

Return to query results.
Submit another query.