DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sodh-2 and Fdh

Sequence 1:NP_524311.1 Gene:Sodh-2 FlyBaseID:FBgn0022359 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_524310.1 Gene:Fdh FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster

Alignment Length:385 Identity:94/386 (24%)
Similarity:152/386 (39%) Gaps:98/386 (25%)


  Fly    13 IEDLRLEQRPIPEIAD---DEVLLAMDSVGICGSDVHYLAHGRIGDFVLTK-------PMIIGHE 67
            |||:        |:|.   .||.:.:.:.|:|.:|.          |.|:.       |:::|||
  Fly    25 IEDI--------EVAPPKAHEVRIKITATGVCHTDA----------FTLSGADPEGLFPVVLGHE 71

  Fly    68 AAGVVAKLGKKVTTLKVGDRVAIEPGVP-CRYCDHCKQGRYNLCADM------------------ 113
            .||:|..:|:.||..|.||.| |...:| |..|..||.|:.|||..:                  
  Fly    72 GAGIVESVGEGVTNFKAGDHV-IALYIPQCNECKFCKSGKTNLCQKIRLTQGAGVMPEGTSRLSC 135

  Fly   114 ------VFCATPPYDGNLTRYYKHAADFCF-KLPDHVSMEEGALLE-PLSVGVHAC-RRAGVGLG 169
                  .|..|..:     ..|...||... |:.:...:|:..||. .:|.|..|. ..|.|..|
  Fly   136 KGQQLFHFMGTSTF-----AEYTVVADISLTKINEKAPLEKVCLLGCGISTGYGAALNTAKVEAG 195

  Fly   170 SKVLILGAGPIGLVTLLAAQAMGASEILITDLVQQRLDVAKELGATHTLLLQRDQSAEETVKVVH 234
            |...:.|.|.:||...|..:..||.:|...|:...:.::||:.|.| ..:..:|.:.:.:::   
  Fly   196 STCAVWGLGAVGLAVGLGCKKAGAGKIYGIDINPDKFELAKKFGFT-DFVNPKDVADKGSIQ--- 256

  Fly   235 QTMSEVPDKSID----CCGAESSARLAIFATRSG-GVVVVVGM-GAPEVKLPLINALAREIDIR- 292
            ..:.::.|...|    |.|..::.|.|:.||..| |..||:|: ||           .:||..| 
  Fly   257 NYLIDLTDGGFDYTFECIGNVNTMRSALEATHKGWGTSVVIGVAGA-----------GQEISTRP 310

  Fly   293 --------------GVFRYCNDYSAALALVASGKVNVKRLVTHHYDITETAEAFETSRRG 338
                          |.:|..:|....:.......:.|...:||...:::..|||:...:|
  Fly   311 FQLVVGRVWKGSAFGGWRSVSDVPKLVEDYLKKDLLVDEFITHELPLSQINEAFDLMHKG 370

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sodh-2NP_524311.1 PLN02702 4..346 CDD:215378 94/386 (24%)
sorbitol_DH 8..349 CDD:176188 94/386 (24%)
FdhNP_524310.1 FrmA 9..379 CDD:223990 94/386 (24%)
alcohol_DH_class_III 9..378 CDD:176260 94/386 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116914332
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.