DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sodh-2 and sodh-2

Sequence 1:NP_524311.1 Gene:Sodh-2 FlyBaseID:FBgn0022359 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_505992.1 Gene:sodh-2 WormBaseID:WBGene00010791 Length:351 Species:Caenorhabditis elegans

Alignment Length:322 Identity:83/323 (26%)
Similarity:135/323 (42%) Gaps:47/323 (15%)


  Fly    16 LRLEQRPIPEIADDEVLLAMDSVGICGSDVHYLAHGRIGDFVLTK--PMIIGHEAAGVVAKLGKK 78
            |.:.|..:|:..::|:|:.::..|||.||:|...    |||....  |:|.|||.||.|..:|.|
 Worm    22 LEVRQVSVPQPQENELLVKIEYSGICHSDLHTWE----GDFEYASICPLIGGHEGAGTVVTIGSK 82

  Fly    79 VTTLKVGDRVAIE-PGVPCRYCDHCKQGRYNLCADMVFCATPPYDGNLTRYYKHAADFCFKLPDH 142
            |....:|||..|: ....|..|::||.|...|| |.:........|....|.........|:.:.
 Worm    83 VKGWNIGDRAGIKLINANCLNCEYCKTGHEPLC-DHIQNYGIDRHGTFQEYLTIRDIDAIKVSND 146

  Fly   143 VSMEEGALLEPLSVGVHA---CRRAGVGLGSKVLILGA-GPIGLVTLLAAQAMGASEILITDLVQ 203
            .::...|.:  |..||.|   .:...|..|..|::.|| |.:|...:..|:|||...:.:..:.:
 Worm   147 TNLAAAAPV--LCGGVTAYKSLKATNVKPGQIVVLTGAGGGLGSFGIQYAKAMGMRVVAVDHISK 209

  Fly   204 QRLDVAKELGATHTLLLQRDQSAEETVKVV-----------HQTMSEVPDKSIDCCGAESSARLA 257
            :  |..:.|||...:      .|.:|..:|           |..:|        ...|:.....|
 Worm   210 E--DHCRNLGAEWFV------DAFDTPDIVAHIRKLTNGGAHGVVS--------FAAAKKPMEYA 258

  Fly   258 IFATRSGGVVVVVGMGAPE---VKLPLINALAREIDIRG-VFRYCNDYSAALALVASGKVNV 315
            :...|..|.||.||:  |:   :.|..::.:..||.::| :.....|...|:..:..|.|:|
 Worm   259 LEYVRKRGTVVFVGL--PKDGTIPLDTLSLICNEITVKGSIVGSRMDVDEAIDFITRGIVHV 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sodh-2NP_524311.1 PLN02702 4..346 CDD:215378 83/323 (26%)
sorbitol_DH 8..349 CDD:176188 83/323 (26%)
sodh-2NP_505992.1 AdhP 7..349 CDD:223992 83/323 (26%)
CAD3 10..348 CDD:176257 83/323 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D605481at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.