DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sodh-2 and R04B5.5

Sequence 1:NP_524311.1 Gene:Sodh-2 FlyBaseID:FBgn0022359 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_505591.1 Gene:R04B5.5 WormBaseID:WBGene00011003 Length:347 Species:Caenorhabditis elegans

Alignment Length:347 Identity:179/348 (51%)
Similarity:255/348 (73%) Gaps:2/348 (1%)


  Fly     1 MATDNLTAVLHGIEDLRLEQRPIPEIADDEVLLAMDSVGICGSDVHYLAHGRIGDFVLTKPMIIG 65
            |:.|||:|||:|::||||||.|||:...::||:.:.:||||||||||..||.||.||:.:|||:|
 Worm     1 MSQDNLSAVLYGVDDLRLEQVPIPKPGPNQVLVKVHTVGICGSDVHYWTHGAIGPFVVKEPMIVG 65

  Fly    66 HEAAGVVAKLGKKVTTLKVGDRVAIEPGVPCRYCDHCKQGRYNLCADMVFCATPPYDGNLTRYYK 130
            ||.:|:|:::|.:|..||||||:|:|||:||:.|:|||.||||||.:|.|.||||..|.|:|:..
 Worm    66 HETSGIVSEVGNEVKHLKVGDRIAMEPGLPCKLCEHCKTGRYNLCPEMRFFATPPVHGTLSRFVV 130

  Fly   131 HAADFCFKLPDHVSMEEGALLEPLSVGVHACRRAGVGLGSKVLILGAGPIGLVTLLAAQAMGASE 195
            |.|||||||||::|.|:|||:|||||.:|||||..|.:|.:||:|||||||::.|:.|:|:||.:
 Worm   131 HDADFCFKLPDNLSFEDGALIEPLSVAIHACRRGNVQMGHRVLVLGAGPIGVLNLITAKAVGAGK 195

  Fly   196 ILITDLVQQRLDVAKELGATHTLLLQRDQSAEETVKVVHQTMSEVPDKSIDCCGAESSARLAIFA 260
            ::||||...||.:||:|||..|:.::.........:::.....:.||..|:|.||:.|...||..
 Worm   196 VVITDLDDGRLALAKKLGADATINVKGKSLDAVKSEIITALGDQQPDVCIECTGAQPSIETAITT 260

  Fly   261 TRSGGVVVVVGMGAPEVKLPLINALAREIDIRGVFRYCNDYSAALALVASGKVNVKRLVTHHYDI 325
            |:||||:|:||:||..|::|:|.:..||:|:||:|||.|.|..|:.|::|||:|:..|...||.:
 Worm   261 TKSGGVIVLVGLGADRVEIPIIESATREVDMRGIFRYVNCYPTAIELISSGKLNLSGLTRAHYKL 325

  Fly   326 TETAEAFETSRRGTGGAIKVMI 347
            .||.|||:.:::  ...|||.|
 Worm   326 EETQEAFKRTQK--ADVIKVFI 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sodh-2NP_524311.1 PLN02702 4..346 CDD:215378 177/342 (52%)
sorbitol_DH 8..349 CDD:176188 175/341 (51%)
R04B5.5NP_505591.1 PLN02702 3..343 CDD:215378 176/342 (51%)
sorbitol_DH 7..347 CDD:176188 175/342 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C232634626
eggNOG 1 0.900 E1_COG1063
Hieranoid 1 1.000
Homologene 1 1.000 H56080
Inparanoid 1 1.050 379 1.000 Inparanoid score I1187
Isobase 1 0.950 0 Normalized mean entropy S593
OMA 1 1.010
OrthoDB 1 1.010 D1019156at2759
OrthoFinder 1 1.000 FOG0002115
OrthoInspector 1 1.000 T98086
orthoMCL 1 0.900 OOG5_126928
Panther 1 1.100 LDO PTHR43161
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R311
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.