DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MED7 and MED7

Sequence 1:NP_731500.1 Gene:MED7 FlyBaseID:FBgn0051390 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_014506.1 Gene:MED7 SGDID:S000005495 Length:222 Species:Saccharomyces cerevisiae

Alignment Length:221 Identity:67/222 (30%)
Similarity:106/222 (48%) Gaps:50/222 (23%)


  Fly     1 MSNQE-TQVSSLPMPPERYIANYTDENIR-------------RNRAPRP---------------- 35
            |||.. .:||||..||..|:..:|..|:.             :..||..                
Yeast     1 MSNDPGNEVSSLYPPPPPYVKFFTQSNLEKLPKYKEKKAASAKQTAPNNSNGGSEEEITCALDYL 65

  Fly    36 -PPPPAQHEVYSMFGIQYNNDEMIRSLESQNIKRLIPIHFDRR--------KELKKLNHSLLVNF 91
             |||..:::.|..||..:...:.:..|||..:.:|.....:..        :||:||..|||:|:
Yeast    66 IPPPMPKNQQYRAFGSIWQVKDQLPDLESMGLTQLYKKSTENESTNYQYKIQELRKLLKSLLLNY 130

  Fly    92 LDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARETLRVMMEMQ---KR---QRVE 150
            |:||..|.:|||...|  |:::|..:.||:||||||:||||:||:|.:::|.|   ||   :.:|
Yeast   131 LELIGVLSINPDMYER--KVENIRTILVNIHHLLNEYRPHQSRESLIMLLEEQLEYKRGEIREIE 193

  Fly   151 TAARFQKH--LERVREIVNTAFSALP 174
            ...: |.|  |..:::.:.|...:.|
Yeast   194 QVCK-QVHDKLTSIQDTLRTGSQSPP 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED7NP_731500.1 Med7 8..166 CDD:283604 62/204 (30%)
MED7NP_014506.1 Med7 20..203 CDD:310518 57/202 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1009511
eggNOG 1 0.900 E1_KOG0570
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I1567
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004448
OrthoInspector 1 1.000 T1136100
orthoMCL 1 0.900 OOG5_129702
Panther 1 1.100 LDO PTHR21428
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R706
TreeFam 1 0.960
1110.780

Return to query results.
Submit another query.