DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED7 and AT5G03220

DIOPT Version :10

Sequence 1:NP_731500.1 Gene:MED7 / 41288 FlyBaseID:FBgn0051390 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_195942.1 Gene:AT5G03220 / 831902 AraportID:AT5G03220 Length:168 Species:Arabidopsis thaliana


Alignment Length:162 Identity:59/162 - (36%)
Similarity:89/162 - (54%) Gaps:6/162 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PPERYIANYTDENIRRNRAPRPPPPPAQHEVYSMFGIQYNNDEMIRSLESQNIKRLIP--IHFDR 76
            ||..|...|.|.:...|.||.||||  ....|..||..|..::::.|||.|.:.:|.|  .:.|.
plant     8 PPPPYYRLYKDYSENPNSAPEPPPP--IEGTYVCFGGNYTTEDVLPSLEEQGVPQLYPKDSNLDY 70

  Fly    77 RKELKKLNHSLLVNFLDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARETLRVMM 141
            :.||:.||..|.::.|:|.|.|:..|.  :..::|.:||.:|.|:|||||..||||||.||..:|
plant    71 KNELRSLNRELQLHILELADVLVDRPS--QYAKRIGEISSIFKNLHHLLNSLRPHQARATLIHIM 133

  Fly   142 EMQKRQRVETAARFQKHLERVREIVNTAFSAL 173
            |:|.:||.:.....::..|..:.::..|:..|
plant   134 ELQIQQRKQAVEDIKRRREEAQRLLKDAYLTL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED7NP_731500.1 Med7 8..166 CDD:461794 57/153 (37%)
AT5G03220NP_195942.1 Med7 <34..158 CDD:461794 45/125 (36%)

Return to query results.
Submit another query.