DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MED7 and AT5G03220

Sequence 1:NP_731500.1 Gene:MED7 FlyBaseID:FBgn0051390 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_195942.1 Gene:AT5G03220 AraportID:AT5G03220 Length:168 Species:Arabidopsis thaliana

Alignment Length:162 Identity:59/163 (36%)
Similarity:89/163 (55%) Gaps:6/163 (4%)


  Fly    14 PPERYIANYTDENIRRNRAPRPPPPPAQHEVYSMFGIQYNNDEMIRSLESQNIKRLIP--IHFDR 76
            ||..|...|.|.:...|.||.||||  ....|..||..|..::::.|||.|.:.:|.|  .:.|.
plant     8 PPPPYYRLYKDYSENPNSAPEPPPP--IEGTYVCFGGNYTTEDVLPSLEEQGVPQLYPKDSNLDY 70

  Fly    77 RKELKKLNHSLLVNFLDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARETLRVMM 141
            :.||:.||..|.::.|:|.|.|:..|.  :..::|.:||.:|.|:|||||..||||||.||..:|
plant    71 KNELRSLNRELQLHILELADVLVDRPS--QYAKRIGEISSIFKNLHHLLNSLRPHQARATLIHIM 133

  Fly   142 EMQKRQRVETAARFQKHLERVREIVNTAFSAL 173
            |:|.:||.:.....::..|..:.::..|:..|
plant   134 ELQIQQRKQAVEDIKRRREEAQRLLKDAYLTL 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED7NP_731500.1 Med7 8..166 CDD:283604 57/154 (37%)
AT5G03220NP_195942.1 Med7 <34..158 CDD:283604 45/126 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H3153
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1356482at2759
OrthoInspector 1 1.000 T124665
orthoMCL 1 0.900 OOG5_129702
Panther 1 1.100 LDO PTHR21428
Phylome 1 0.910 0.667 Consistency score
87.930

Return to query results.
Submit another query.