DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MED7 and Med7

Sequence 1:NP_731500.1 Gene:MED7 FlyBaseID:FBgn0051390 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001273112.1 Gene:Med7 RGDID:6494481 Length:233 Species:Rattus norvegicus

Alignment Length:228 Identity:119/229 (52%)
Similarity:157/229 (69%) Gaps:23/229 (10%)


  Fly     7 QVSSLPMPPERYIANYTDENIRRNRAPRPPPPPAQHEVYSMFGIQYNNDEM-IRSLESQNIKRLI 70
            |||:||.||.:||..||||||:...||:||||  ..:.|.|||.|:..|:: ||.||||.|:||.
  Rat     6 QVSALPPPPMQYIKEYTDENIQEGLAPKPPPP--IKDSYMMFGNQFQCDDLIIRPLESQGIERLH 68

  Fly    71 PIHFDRRKELKKLNHSLLVNFLDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARE 135
            |:.||.:|||:|||.|:|:|||||:|.||.:|.|.:|.||::|:.||||::|||:||:|||||||
  Rat    69 PMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARE 133

  Fly   136 TLRVMMEMQKRQRVETAARFQKHLERVREIVNTAFSALPVLDD-DDDSGGAKIKTEVDPLE---- 195
            |||||||:|||||:|||.|||||||||.|::....::||  || .....|.::|||  |::    
  Rat   134 TLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLP--DDLPHSEAGMRVKTE--PMDTDDN 194

  Fly   196 ANAAAKN-----------DPSYQHDRMLCKLVD 217
            :|...:|           |...:.|..||.|:|
  Rat   195 SNCTGQNEQQRESSGHRRDQIIEKDAALCVLID 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED7NP_731500.1 Med7 8..166 CDD:283604 101/159 (64%)
Med7NP_001273112.1 Med7 7..164 CDD:283604 101/159 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0570
Hieranoid 1 1.000
Homologene 1 1.000 H3153
Inparanoid 1 1.050 218 1.000 Inparanoid score I3442
OMA 1 1.010
OrthoDB 1 1.010 D1356482at2759
OrthoFinder 1 1.000 FOG0004448
OrthoInspector 1 1.000 T1087121
orthoMCL 1 0.900 OOG5_129702
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1110.740

Return to query results.
Submit another query.