DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pug and mthfd1a

Sequence 1:NP_001014614.1 Gene:pug FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_021329049.1 Gene:mthfd1a ZFINID:ZDB-GENE-041001-127 Length:919 Species:Danio rerio

Alignment Length:925 Identity:450/926 (49%)
Similarity:611/926 (66%) Gaps:32/926 (3%)


  Fly    38 AKIISGTAVAKSIREELRNEVTAMSKQLADFVPGLRIVQVGGREDSNVYIRMKIKAATEIGIDAA 102
            |.::||...::.:::.|:.||..|..|...|.|||.::|||.|||||:||.||:|||.||||:|.
Zfish    25 ATVVSGNKTSQQVKQRLKEEVEQMKSQFPGFRPGLVVLQVGDREDSNLYISMKLKAAAEIGINAN 89

  Fly   103 HVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRITDAVSPEKDVDGLHTVNEG 167
            |::||.:.||.|:|..|..:||:|..||:|||:|||...||::.:||:||:||||||||.::|.|
Zfish    90 HIRLPETATENEVLRNIVAVNENPAFHGLIVQLPLDSINPINTEKITNAVAPEKDVDGLTSINAG 154

  Fly   168 RLAIGDLGG-FLPCTPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAELLKWANATVTVCHSK 231
            :|:.||||. |:||||.||:|||.::||.:.|..|||:|||||||.|..:||.|::||||.||||
Zfish   155 KLSRGDLGDCFIPCTPNGCMELISQTGVSVMGKNAVVIGRSKIVGAPMHDLLLWSHATVTTCHSK 219

  Fly   232 TRNLEEITRSADILVVGIGVAEMVKGSWIKPGAVVIDCGINVKPDASKASGSKLVGDVDYAEALQ 296
            |.:|.|....|||||||.|.||||||.|:|.||||||||||..||.|||||.::||||.|..|.|
Zfish   220 TPDLAEQVGKADILVVGAGRAEMVKGEWVKEGAVVIDCGINHIPDESKASGKRVVGDVHYPSAKQ 284

  Fly   297 VAGHLTPVPGGVGPMTVAMLMKNTVRSAARFLERLAKSQWALQTLPLKPQRPVPSDIVIARAQKP 361
            .||.:||||||||||||||||||||.||.|||:.....:|.|.....:|..|.|||..|:.:.:.
Zfish   285 RAGFITPVPGGVGPMTVAMLMKNTVESAKRFLQTHTPGKWNLVYTKKRPHEPQPSDAAISSSCES 349

  Fly   362 KDIAVLAKEIGLEAREVSLYGNKKAKISLSVLERLKDKEVGHYVVVAGMTPTPLGEGKTTTLMGL 426
            |.:..||:|:||.:.||..||..:|||.|..|:|::.:..|.||||.|:|.:||||||.||.:||
Zfish   350 KPVVQLARELGLFSDEVESYGRSRAKIRLDALKRMEKQPNGKYVVVTGVTSSPLGEGKRTTALGL 414

  Fly   427 VQALGAHKLRNTMAALRQPSQGPTFGIKGGAAGGGYAQVIPMEEFNLHLTGDIHAVSAANNLLAA 491
            .||||||...|..|.:::.|....||.:|.|.||||:|:||:||.:|..:|....||||..|:..
Zfish   415 AQALGAHLNTNAFACVQKSSLETCFGARGPAVGGGYSQIIPLEEVSLQPSGQNELVSAAGRLVMD 479

  Fly   492 QLDTRIFHENTQKDKALYDRLVPAIKGQRKFSPIQLRRLQKLGITKTDPDTLTADEYGPFARLDI 556
            .:.....:|....:|||:|.|||..:|||..|..||.||:||.|.|:||.|||..|...|.||||
Zfish   480 TVKAYAHYETKLSEKALFDLLVPLREGQRCVSLAQLNRLKKLAIEKSDPLTLTEREIRRFIRLDI 544

  Fly   557 DPDTIMWERVVDINDRYLRTITVGQSPTEKGISRETRFSISVASEIMAVLALSRSLEDMKQRLAD 621
            |.|                      |.|:         |.|:.:|:||||:||.|.|:|:.|||:
Zfish   545 DTD----------------------SATD---------SFSLENEMMAVLSLSSSEEEMQHRLAN 578

  Fly   622 MVVAFDKRGKPVTADDLGVTGALAVLLKDALEPNLMQSLEGTPVLVHAGPFANIAHGCNSIIADE 686
            ::||.:|.|.|:|.:||.|:|.||:|||:||:|.|||::|||||.:|..|..|:|.|..||:||:
Zfish   579 IIVATNKSGDPITTEDLNVSGPLAMLLKEALKPVLMQTVEGTPVFLHTSPLVNVAQGGPSILADK 643

  Fly   687 VGLKLVGKNGFVCTEAGFGSDIGMEKFCNIKCRTSGRKPNAMVLVATVRAIKMHGGGAPVTPGAP 751
            :.||:||..|||.||:|.|:|:|:|||.||||..||.:|:.:|:|||:|.:||.||..|:..|.|
Zfish   644 MALKIVGSEGFVVTESGHGADVGLEKFFNIKCLYSGLQPDVLVMVATIRTLKMQGGAPPIQAGLP 708

  Fly   752 LNKQYTEENLELVQKGLPNLLQHIENGKAFGMPVVVSLNAHSADTPAEHELVKKAALEAGAFAAV 816
            |.|:|.:|||:.:::|..::.:.:|..:|||:||:|::|..|:||.||.|||...|.:||||.||
Zfish   709 LPKEYLQENLKQLERGCCHMRRQVEKAQAFGLPVIVAVNKFSSDTDAELELVCGQARQAGAFDAV 773

  Fly   817 VSTHWADGGAGAVQLADAVIKACEQGNQFRLLYDLELPLVDKMNKIATTMYGAGKVVLSPAAEEK 881
            ..:.|::|||||:.||:.|.:|.:....|:.||||:.|..||:..:|..|||...|.|||.|:||
Zfish   774 QCSSWSEGGAGALALAETVQRAAKLPACFKFLYDLQTPASDKLRTVAQKMYGLKDVKLSPKAKEK 838

  Fly   882 VKRLTDAGFGNLPICMSKVSGSFTGDAKIKGAPKGFTLDVEDVYVSAGAGFVVAMCGEVTKMPGL 946
            :...|..||.|||:|::|...|.:.|..:||:...|.|.:.|:..:|||||:..:.|........
Zfish   839 LALYTKQGFENLPVCIAKTPLSLSNDPMMKGSSTDFMLPITDIKANAGAGFLCCLTGSTNAEMDD 903

  Fly   947 PTRPAIYDIDLNTET 961
            |..|..:..:|.:::
Zfish   904 PMWPCFHGNNLYSDS 918

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 176/292 (60%)
THF_DHG_CYH 40..159 CDD:279147 61/119 (51%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 116/171 (68%)
FTHFS 350..968 CDD:279592 269/613 (44%)
mthfd1aXP_021329049.1 FolD 26..315 CDD:223268 174/289 (60%)
FTHFS 353..897 CDD:238266 261/575 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D690393at2759
OrthoFinder 1 1.000 FOG0000990
OrthoInspector 1 1.000 T596266
orthoMCL 1 0.900 OOG5_126671
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.680

Return to query results.
Submit another query.