DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pug and Mthfd2

Sequence 1:NP_001014614.1 Gene:pug FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_011239547.1 Gene:Mthfd2 MGIID:1338850 Length:353 Species:Mus musculus

Alignment Length:315 Identity:134/316 (42%)
Similarity:189/316 (60%) Gaps:24/316 (8%)


  Fly    28 TAEPAIKMSGAKIISGTAVAKSIREELRNE----VTAMSKQLADFVPGLRIVQVGGREDSNVYIR 88
            ||:|..: :.|.:|||..:|:.|::|::.|    |.:.:|:     |.|.::.||....|:.|:.
Mouse    31 TADPPHR-NEAVVISGRKLAQQIKQEVQQEVEEWVASGNKR-----PHLSVILVGDNPASHSYVL 89

  Fly    89 MKIKAATEIGIDAAHVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRITDAVS 153
            .|.:||.|:||::..:..|.|::|.|||:.|..||.|..|.|::||:||  ...||..::.:|||
Mouse    90 NKTRAAAEVGINSETIVKPASVSEEELLNSIRKLNNDENVDGLLVQLPL--PEHIDERKVCNAVS 152

  Fly   154 PEKDVDGLHTVNEGRLAIGDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAELL 218
            |:|||||.|.:|.||:.: |....||.||||..|:|:|:|:...|...||.||||.||.|.|.||
Mouse   153 PDKDVDGFHVINVGRMCL-DQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLL 216

  Fly   219 --------KWANATVTVCHSKT--RNLEEITRSADILVVGIGVAEMVKGSWIKPGAVVIDCGINV 273
                    ...:||||:.|..|  ..|::.|..|||::...|:..::....||.||.|||.|||.
Mouse   217 HTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINR 281

  Fly   274 KPDASKASGSKLVGDVDYAEALQVAGHLTPVPGGVGPMTVAMLMKNTVRSAARFL 328
            ..|...|. .|||||||:....:.||::|||||||||||||||||||:.:|.:.|
Mouse   282 VQDPVTAK-PKLVGDVDFEGVKKKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVL 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 130/305 (43%)
THF_DHG_CYH 40..159 CDD:279147 46/123 (37%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 86/180 (48%)
FTHFS 350..968 CDD:279592
Mthfd2XP_011239547.1 FolD 42..336 CDD:223268 130/304 (43%)
THF_DHG_CYH 42..158 CDD:279147 46/123 (37%)
NAD_bind_m-THF_DH_Cyclohyd 153..332 CDD:133448 87/181 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113156174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126671
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.