DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14683 and Mettl15

Sequence 1:NP_788632.1 Gene:CG14683 FlyBaseID:FBgn0037822 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_084066.2 Gene:Mettl15 MGIID:1924144 Length:406 Species:Mus musculus

Alignment Length:346 Identity:155/347 (45%)
Similarity:209/347 (60%) Gaps:30/347 (9%)


  Fly    27 HVPVLCDTAIEYLQPVPGGTYFDMTFGAGGHTRRLLEKCPEAKVYALDRDPLAHQLARDMSESEE 91
            |:||:.|..:..|.|..|..:.|||||:|||||.:|:|.|:..||||||||:|:.:|..:|    
Mouse    72 HIPVMVDQVVHCLAPQKGQVFLDMTFGSGGHTRAILQKEPDVMVYALDRDPVAYAIAEQLS---- 132

  Fly    92 FKGRLIP-----LLGKFSDLPKLFKEHGLAKNSVDGMLFDFGCSSMQFDEAVRGFSISRDGPLDM 151
               ||.|     |||:||....|..:.|:...::||:|.|.||||||.|...||||:.:||||||
Mouse   133 ---RLYPTQIQALLGQFSQAEALLMKAGVQPGTIDGILMDLGCSSMQLDAPERGFSLRKDGPLDM 194

  Fly   152 RMDGG-HSGGVTAADVLANVEEGDLVKILRMYGEEKAAKKIARGLVDARNALFKIETTKQLADII 215
            ||||. :....||:||:..:::..|..|||.|||||.|||||..::.||:. :.|..|:|||.|:
Mouse   195 RMDGDRYPDTPTASDVVNALDQQALASILRAYGEEKHAKKIASAIIQARST-YPISRTQQLASIV 258

  Fly   216 ENIMDGG---TRKDKLRRPAHSATKTFQAIRIFVNNELNEINYGMVLANEILRVDGRLVTITFHS 277
            .......   .|||.|:|..|.|||||||:||||||||||:..|:..|.:.|:..||||.::|||
Mouse   259 AGAFPPSAVYARKDLLQRSTHIATKTFQALRIFVNNELNELYAGLRTAEKFLKTGGRLVALSFHS 323

  Fly   278 LEDTIVKRHINGNVLAGAAN---ALPLKYSSHYAIDEPDILESLTKKS------WKQLHRHVIVP 333
            |||.||||.:.|..:....|   ...:|.:|....|:    |:..:.|      |:.:|:.|:.|
Mouse   324 LEDRIVKRFLLGISMTERFNLSIRQKVKQTSQLDSDQ----ETEERHSVRAPLKWELIHKKVLTP 384

  Fly   334 DADEVARNTRSRSAKLRAAVK 354
            :..:|..|.|.||||||||:|
Mouse   385 EDQDVQDNPRGRSAKLRAAIK 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14683NP_788632.1 PRK00050 26..356 CDD:234597 155/347 (45%)
Mettl15NP_084066.2 PRK00050 72..406 CDD:234597 155/347 (45%)
S-adenosyl-L-methionine binding. {ECO:0000250} 100..102 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C212271637
eggNOG 1 0.900 E1_COG0275
Hieranoid 1 1.000
Homologene 1 1.000 H12661
Inparanoid 1 1.050 266 1.000 Inparanoid score I3017
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007756
OrthoInspector 1 1.000 T1084193
orthoMCL 1 0.900 OOG5_127913
Panther 1 1.100 LDO PTHR11265
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4657
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.