DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14683 and mettl15

Sequence 1:NP_788632.1 Gene:CG14683 FlyBaseID:FBgn0037822 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001314836.1 Gene:mettl15 ZFINID:ZDB-GENE-130530-958 Length:402 Species:Danio rerio

Alignment Length:382 Identity:156/383 (41%)
Similarity:218/383 (57%) Gaps:37/383 (10%)


  Fly     4 LLNPTRLRLDWLRRS-------SIDVTTAP------------HVPVLCDTAIEYLQPVPGGTYFD 49
            |.||...|..| |:|       :..|.::|            |.||:....:::|...||....|
Zfish    26 LRNPRMFRRCW-RKSWHPGRLYTGSVPSSPDCEMPVQEEKPFHTPVMVKEVLQFLNIKPGQIVLD 89

  Fly    50 MTFGAGGHTRRLLEKCPEAKVYALDRDPLAHQLARDMSESEEFKGRLIPLLGKFSDLPKLFKEHG 114
            :|||||||::.:|:..|...|.|.||||.|.::|:.:  :||::|::.|:||:||:|..|....|
Zfish    90 LTFGAGGHSKAILQSVPGVTVVAADRDPTAFRMAQQL--AEEYQGKVKPVLGRFSELNNLLPALG 152

  Fly   115 LAKNSVDGMLFDFGCSSMQFDEAVRGFSISRDGPLDMRMDGGHSGGV-TAADVLANVEEGDLVKI 178
            |...:||..|.|.||||||.|.|.||||:|:||||||||||.....: .||||:..:::..|..:
Zfish   153 LGPGTVDAALLDAGCSSMQMDSAERGFSLSKDGPLDMRMDGDRYPDMPCAADVVNALDQQALASV 217

  Fly   179 LRMYGEEKAAKKIARGLVDARNALFKIETTKQLADIIENIMDGG---TRKDKLRRPAHSATKTFQ 240
            |..||||:..:|||..:..|| :::.|..|.|||.|:.......   .|:|:|:||:|.||||||
Zfish   218 LAAYGEERHTRKIAAAIAQAR-SVYPIGRTLQLASIVAGAFPASALYARRDRLQRPSHVATKTFQ 281

  Fly   241 AIRIFVNNELNEINYGMVLANEILRVDGRLVTITFHSLEDTIVKRHINGNVLAGA--------AN 297
            |:|||||:||||::.|:.:|..:||..|||..:|||||||.:.||.:.|..||..        |.
Zfish   282 ALRIFVNDELNELHAGLRVAQTLLRPKGRLCVLTFHSLEDRLTKRFLRGEDLAAPPRRSLRQHAR 346

  Fly   298 ALPLKYSSHYAIDEPDILESLTKKSWKQLHRHVIVPDADEVARNTRSRSAKLRAAVK 354
            |.|......:. :|.:..|......|..| :.||.|..:||..|.|:||||||.||:
Zfish   347 ARPAGQEEEFE-EEEEGDEGGNSVHWVSL-KKVIKPSEEEVQENPRARSAKLRTAVR 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14683NP_788632.1 PRK00050 26..356 CDD:234597 148/354 (42%)
mettl15NP_001314836.1 PRK00050 67..401 CDD:234597 147/339 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C212269960
eggNOG 1 0.900 E1_COG0275
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H12661
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D415187at33208
OrthoFinder 1 1.000 FOG0007756
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11265
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.