DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14683 and Mettl15

Sequence 1:NP_788632.1 Gene:CG14683 FlyBaseID:FBgn0037822 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_006234748.1 Gene:Mettl15 RGDID:1304978 Length:406 Species:Rattus norvegicus

Alignment Length:340 Identity:153/341 (45%)
Similarity:211/341 (62%) Gaps:18/341 (5%)


  Fly    27 HVPVLCDTAIEYLQPVPGGTYFDMTFGAGGHTRRLLEKCPEAKVYALDRDPLAHQLARDMSESEE 91
            |:||:.|..::.|.|..|..:.|||||:|||::.:|:|.|:..||||||||:|..||..:||.  
  Rat    72 HIPVMVDEVVQCLTPQKGQVFLDMTFGSGGHSKAILQKEPDVTVYALDRDPVAFTLAERLSEM-- 134

  Fly    92 FKGRLIPLLGKFSDLPKLFKEHGLAKNSVDGMLFDFGCSSMQFDEAVRGFSISRDGPLDMRMDGG 156
            :..::..:||:||....|..:.|:...:|||:|.|.||||||.|...||||:.:||||||||||.
  Rat   135 YPTQIHAMLGQFSQAETLLMKAGVQPGTVDGVLLDLGCSSMQLDAPERGFSLRKDGPLDMRMDGD 199

  Fly   157 HSGGV-TAADVLANVEEGDLVKILRMYGEEKAAKKIARGLVDARNALFKIETTKQLADIIENIMD 220
            ....: |||||:..:::..|..|||.|||||.|||||..::.||:. :.|..|:|||.|:.....
  Rat   200 RYPDMPTAADVVNALDQQALASILRAYGEEKHAKKIASAIIQARST-YPISRTQQLASIVAGAFP 263

  Fly   221 GG---TRKDKLRRPAHSATKTFQAIRIFVNNELNEINYGMVLANEILRVDGRLVTITFHSLEDTI 282
            ..   .|||.|:|..|.|||||||:||||||||||:..|:..|.:.|:..||||.::||||||.|
  Rat   264 PSAIYARKDLLQRSTHIATKTFQALRIFVNNELNELYTGLRTAQKFLKPGGRLVALSFHSLEDRI 328

  Fly   283 VKRHINGNVLAGAANALPLK--------YSSHYAIDEPDILESLTKKSWKQLHRHVIVPDADEVA 339
            |||.:.|..:....| |.::        ..|.:.|:|...:.:..|  |:.:|:.|:.|:..:|.
  Rat   329 VKRFLLGISMTERFN-LSIRQKVRQTSQMDSDHEIEERRCVRAPLK--WELIHKKVLTPEDQDVQ 390

  Fly   340 RNTRSRSAKLRAAVK 354
            .|.|.||||||||:|
  Rat   391 ANPRGRSAKLRAAIK 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14683NP_788632.1 PRK00050 26..356 CDD:234597 153/341 (45%)
Mettl15XP_006234748.1 PRK00050 72..406 CDD:234597 153/341 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C212272650
eggNOG 1 0.900 E1_COG0275
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3974
OMA 1 1.010
OrthoDB 1 1.010 D415187at33208
OrthoFinder 1 1.000 FOG0007756
OrthoInspector 1 1.000 T1087744
orthoMCL 1 0.900 OOG5_127913
Panther 1 1.100 LDO PTHR11265
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.