DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14683 and METTL15

Sequence 1:NP_788632.1 Gene:CG14683 FlyBaseID:FBgn0037822 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001107000.1 Gene:METTL15 HGNCID:26606 Length:407 Species:Homo sapiens

Alignment Length:339 Identity:154/340 (45%)
Similarity:210/340 (62%) Gaps:15/340 (4%)


  Fly    27 HVPVLCDTAIEYLQPVPGGTYFDMTFGAGGHTRRLLEKCPEAKVYALDRDPLAHQLARDMSESEE 91
            |:||:.|..:..|.|..|..:.|||||:||||:.:|:|..:..:|||||||.|:.||..:||.  
Human    72 HIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDRDPTAYALAEHLSEL-- 134

  Fly    92 FKGRLIPLLGKFSDLPKLFKEHGLAKNSVDGMLFDFGCSSMQFDEAVRGFSISRDGPLDMRMDGG 156
            :..::..:||:||....|..:.|:...:.||:|.|.||||||.|...||||:.:|||||||||||
Human   135 YPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGFSLRKDGPLDMRMDGG 199

  Fly   157 HSGGV-TAADVLANVEEGDLVKILRMYGEEKAAKKIARGLVDARNALFKIETTKQLADIIENIMD 220
            ....: |||||:..:::..|..|||.|||||.|||||..:|.|| :::.|..|:|||.|:.....
Human   200 RYPDMPTAADVVNALDQQALASILRTYGEEKHAKKIASAIVQAR-SIYPITRTQQLASIVAGAFP 263

  Fly   221 GG---TRKDKLRRPAHSATKTFQAIRIFVNNELNEINYGMVLANEILRVDGRLVTITFHSLEDTI 282
            ..   ||||.|:|..|.|||||||:||||||||||:..|:..|.:.||..||||.::||||||.|
Human   264 PSAIYTRKDLLQRSTHIATKTFQALRIFVNNELNELYTGLKTAQKFLRPGGRLVALSFHSLEDRI 328

  Fly   283 VKRHINGNVLAGAANALPLKY----SSHYAIDEPDILESLTKKS---WKQLHRHVIVPDADEVAR 340
            |||.:.|..:....| |.::.    :|....|..:..|...:::   |:.:|:.|:.|...:|..
Human   329 VKRFLLGISMTERFN-LSVRQQVMKTSQLGSDHENTEEVSMRRAPLMWELIHKKVLSPQDQDVQD 392

  Fly   341 NTRSRSAKLRAAVK 354
            |.|.||||||||:|
Human   393 NPRGRSAKLRAAIK 406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14683NP_788632.1 PRK00050 26..356 CDD:234597 154/340 (45%)
METTL15NP_001107000.1 PRK00050 72..407 CDD:234597 154/340 (45%)
HsdM <81..>128 CDD:223363 23/47 (49%)
S-adenosyl-L-methionine binding. {ECO:0000250} 100..102 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C212272636
eggNOG 1 0.900 E1_COG0275
Hieranoid 1 1.000
Homologene 1 1.000 H12661
Inparanoid 1 1.050 265 1.000 Inparanoid score I3011
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D415187at33208
OrthoFinder 1 1.000 FOG0007756
OrthoInspector 1 1.000 T609769
orthoMCL 1 0.900 OOG5_127913
Panther 1 1.100 O PTHR11265
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4657
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.