DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14683 and mettl15

Sequence 1:NP_788632.1 Gene:CG14683 FlyBaseID:FBgn0037822 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001120214.1 Gene:mettl15 XenbaseID:XB-GENE-5822280 Length:375 Species:Xenopus tropicalis

Alignment Length:342 Identity:161/343 (47%)
Similarity:214/343 (62%) Gaps:20/343 (6%)


  Fly    24 TAPHVPVLCDTAIEYLQPVPGGTYFDMTFGAGGHTRRLLEKCPEAKVYALDRDPLAHQLARDMSE 88
            |..||||:.:...|.|.|..|.|..|:||||||||..:|::....||.||||||.|..:|:.::.
 Frog    42 TVLHVPVMVNEVTECLAPQEGQTILDLTFGAGGHTTSILKRASNIKVLALDRDPAAFAIAQQLAH 106

  Fly    89 SEEFKGRLI-PLLGKFSDLPKLFKEHGLAKNSVDGMLFDFGCSSMQFDEAVRGFSISRDGPLDMR 152
            |   .|..| ||||:||:...|....|:...|:||:|.|.||||||||...||||:|||||||||
 Frog   107 S---CGHNIQPLLGRFSESKDLLTSAGVEPGSIDGVLLDAGCSSMQFDTPDRGFSLSRDGPLDMR 168

  Fly   153 MDGGHSGGV-TAADVLANVEEGDLVKILRMYGEEKAAKKIARGLVDARNALFKIETTKQLADIIE 216
            |||.....: |||||:..:::..|..||:.||||:.|||||..:|.|| :::.|..|:|||.|: 
 Frog   169 MDGDRYPDMPTAADVVNALDQQALASILKTYGEERHAKKIASAIVQAR-SIYPITRTQQLASIV- 231

  Fly   217 NIMDGGT---RKDKLRRPAHSATKTFQAIRIFVNNELNEINYGMVLANEILRVDGRLVTITFHSL 278
               .|.:   |.|.|:||||.|||||||:||||||||||::.|:..|...||..||||.|:||||
 Frog   232 ---TGASIQARTDLLQRPAHVATKTFQALRIFVNNELNELHAGLSTAETFLRPGGRLVVISFHSL 293

  Fly   279 EDTIVKRHINGNVLAGAANALPLKYS------SHYAIDEPDILESLTKKSWKQLHRHVIVPDADE 337
            ||.||||.::|..:|...| |..::.      :...:::.:.|.|.:..:|..:.:.|:.|...:
 Frog   294 EDRIVKRFLHGIDMADKPN-LAARHKIRQGQRNSKEMEDEEFLMSHSNPAWTVIQKKVLTPQYQD 357

  Fly   338 VARNTRSRSAKLRAAVK 354
            |..|.|.||||||||:|
 Frog   358 VLENPRGRSAKLRAAIK 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14683NP_788632.1 PRK00050 26..356 CDD:234597 160/341 (47%)
mettl15NP_001120214.1 PRK00050 45..374 CDD:234597 159/338 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C212270768
eggNOG 1 0.900 E1_COG0275
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H12661
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D415187at33208
OrthoFinder 1 1.000 FOG0007756
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.