DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and BLH5

DIOPT Version :10

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001189615.2 Gene:BLH5 / 817264 AraportID:AT2G27220 Length:449 Species:Arabidopsis thaliana


Alignment Length:88 Identity:37/88 - (42%)
Similarity:56/88 - (63%) Gaps:12/88 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 GEEDDDASGKKNQK-----------KRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGL 407
            |:::.|...||..|           :||: |:.|.::||:|||:|..||||.:..|..||:.|||
plant   225 GQKEFDEQLKKLGKMAHHHSNAWRPQRGL-PEKAVSVLRSWLFEHFLHPYPRDLDKVMLAKQTGL 288

  Fly   408 TILQVNNWFINARRRIVQPMIDQ 430
            |..||:|||||||.|:.:|::::
plant   289 TKSQVSNWFINARVRMWKPLVEE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:465140
Homeobox_KN 384..422 CDD:428673 23/37 (62%)
BLH5NP_001189615.2 POX 71..214 CDD:214728
Homeobox_KN 265..303 CDD:428673 23/37 (62%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.